KEGG   Streptococcus mutans GS-5 (serotype c): SMUGS5_02635Help
Entry
SMUGS5_02635      CDS       T02185                                 

Definition
(GenBank) D-alanine-D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
smut  Streptococcus mutans GS-5 (serotype c)
Pathway
smut00473  D-Alanine metabolism
smut00550  Peptidoglycan biosynthesis
smut01100  Metabolic pathways
smut01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:smut00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    SMUGS5_02635
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SMUGS5_02635
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    SMUGS5_02635
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:smut01011]
    SMUGS5_02635
Enzymes [BR:smut01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     SMUGS5_02635
Peptidoglycan biosynthesis and degradation proteins [BR:smut01011]
 Precursor biosynthesis
  Amino acid ligase
   SMUGS5_02635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: AFM81052
LinkDB All DBs
Structure
PDB: 

Position
548105..549154
Genome map
AA seq 349 aa AA seqDB search
MSKETLVLLYGGRSAERDVSVLSAESVMRAINYDNFLVKTYFITQAGDFIKTQEFDSQPS
ETDKLMTNDTIIASQKIKPSDIYEEEAVVFPVLHGPMGEDGSIQGFLEVLKMPYVGTNIL
SSSVAMDKITTKQVLESATTIPQVAYVALIEGEPLESKLAEVEEKLIYPVFVKPANMGSS
VGISKAENRTDLKQAIALALKYDSRVLIEQGVDAREIEVGILGNTDVKTTLPGEIVKDVA
FYDYEAKYIDNKITMAIPAEIDPVIVEKMRDYAATAFRTLGCCGLSRCDFFLTEDGKVYL
NELNTMPGFTQWSMYPLLWENMGLSYSDLIEELVSLAKEMFDKRESHLV
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagaaacgcttgttttattatatggtggccgttctgcagaacgcgatgtttct
gtgctctcagctgagagtgtcatgcgagccataaattatgacaactttttagtcaaaact
tatttcattacgcaagcgggtgactttattaagacgcaagaatttgatagtcaaccatca
gaaactgataaactgatgacaaatgacacgattattgcttctcaaaaaattaagccaagt
gatatttatgaggaagaagcagttgtttttcctgttcttcatgggcctatgggagaggat
ggttctattcagggctttcttgaagttttaaaaatgccttatgtgggaaccaatattctg
tcatctagtgtagctatggataagattacaacaaagcaagttttagaaagtgcgactact
attcctcaagtagcttatgttgctcttattgaaggcgagcctttagaaagcaagttggca
gaagttgaagagaaattgatttatcctgtatttgttaagccagctaatatgggttctagt
gttggtatttctaaagcagaaaatcgcactgacttaaaacaagctattgcacttgctttg
aagtatgacagtcgtgttttaattgaacaaggtgtggatgcgcgtgagattgaggttggt
attttaggaaatactgatgttaaaacaactttaccgggagagattgtcaaagatgtggct
ttttatgattacgaagccaagtatattgataataagatcaccatggctattccggcagaa
atagatcctgttatcgttgaaaaaatgcgggattatgctgcaacagctttccgaactttg
ggctgctgtggactttctcgctgtgatttcttcctaacagaggatgggaaagtttatttg
aatgaactcaacactatgcccggctttactcagtggtctatgtatcctcttctttgggaa
aatatggggctgtcttattcagatttgattgaagaattagttagtcttgctaaagaaatg
tttgacaaacgcgaaagccatttggtttaa

DBGET integrated database retrieval system