KEGG   Streptococcus mutans GS-5 (serotype c): SMUGS5_07160Help
Entry
SMUGS5_07160      CDS       T02185                                 

Definition
(GenBank) cytoplasmic alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
smut  Streptococcus mutans GS-5 (serotype c)
Pathway
smut00500  Starch and sucrose metabolism
smut01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smut00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SMUGS5_07160
Enzymes [BR:smut01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     SMUGS5_07160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70 DUF1939
Motif
Other DBs
NCBI-ProteinID: AFM81927
LinkDB All DBs
Position
complement(1518959..1520419)
Genome map
AA seq 486 aa AA seqDB search
MTNETMMQYFEWYLPNDGKHWQHLAEDASHLKNIGISKVWMPPAFKGTGSNDVGYGVYDL
YDLGEFNQNGTVRTKYGSREDYLNAVNALKEQEIMPISDIVLNHKANGDAKERFQVVKVN
PSNRQEKISEPYEIEGWTQFNFPGRQDNYSDFKWHWYHFTGVDYDALHNENGIYMILGDN
KGWASQENIDQENGNYDYLMYDDIDFKHPEVQEHLRDWVAWFLETSGVGGFRLDAIKHID
KTFMAQFIRYIREHLKADLYVFGEYWKDSHFDITDYLHSVDLQFDLIDVMLHMSLFEAGQ
KGSDFDLSTILDDSLMKSHPDFAVTFVDNHDSQRGQALESTVAEWFKPLAYGLILLRQEG
IPCVFYGDYYGISGEFAQESFQTILDKLLYIRQYHVYGAQEDYFDYANCIGWTCLGDEEH
PDGVAVIISNGEANCKRMNMGEFNRNKVFVDYLNNCTEEVILDGQGWGDFPVQEASLSAW
VNKDAH
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatgaaacaatgatgcagtattttgaatggtatttgccaaacgatggtaagcat
tggcagcatttagctgaagatgccagtcatcttaagaatattgggattagcaaagtttgg
atgccaccggcttttaaaggaacgggttccaatgatgttggctatggcgtttatgatctt
tatgatctgggtgaatttaatcaaaatggaactgtcaggaccaagtatggcagcagggaa
gattatctcaatgctgtgaatgctctgaaggagcaggaaatcatgcctatttccgatatt
gtccttaatcacaaggccaatggtgatgccaaagaaagatttcaagtggttaaagtcaat
cccagcaaccgtcaagaaaagatttctgaaccttatgagattgaaggttggacccagttt
aactttccgggccgacaggataactacagcgatttcaaatggcattggtaccatttcact
ggcgttgattatgacgctcttcataatgaaaatggtatctacatgatcctaggtgataac
aagggttgggccagtcaggaaaatattgatcaggaaaatggtaattatgattacctgatg
tatgatgatattgattttaaacatcctgaagtacaggagcacttgcgagattgggttgct
tggtttttggaaacaagtggtgtcggtggttttcgtttagatgctattaaacatattgat
aagacttttatggcacaatttattcgttatattcgtgagcatcttaaagcagacctttat
gtttttggtgagtactggaaagacagtcatttcgatattaccgattatctccatagtgtt
gacctgcaatttgacctgattgatgttatgctgcacatgagtctctttgaggctggtcaa
aaaggttctgattttgatttgtcaacgattttagacgatagtctgatgaaaagccatcct
gattttgctgttacttttgttgataatcatgattcccaaagagggcaggctttagagtca
acggttgcagagtggtttaaacctttagcttatggtttgattttgttgcgtcaagagggg
attccttgtgtcttttacggtgattactatggtatttcgggtgaatttgctcaggaatct
ttccagactattttagataaactgctttatatcaggcaataccatgtttatggagcgcaa
gaagattattttgactatgccaattgtattggctggacttgtctgggagatgaagagcat
cctgatggtgtggctgttatcatatctaatggggaagctaattgcaaacgaatgaatatg
ggagaatttaatcggaataaggtttttgttgattatcttaataattgtacagaagaagtg
attttagatggtcaaggctggggtgattttccagttcaagaagcttccttgtcagcttgg
gttaataaagatgctcattga

DBGET integrated database retrieval system