KEGG   Serratia marcescens WW4: SMWW4_v1c00700Help
Entry
SMWW4_v1c00700    CDS       T02448                                 

Gene name
sodA
Definition
(GenBank) superoxide dismutase, Mn
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
smw  Serratia marcescens WW4
Brite
Enzymes [BR:smw01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     SMWW4_v1c00700 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N HTH_54
Motif
Other DBs
NCBI-ProteinID: AGE15878
LinkDB All DBs
Position
complement(76236..76856)
Genome map
AA seq 206 aa AA seqDB search
MSYSLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANTVLEAYPELAKYSVEELIQD
LDKVPADKRTFMRNNAGGHANHSFFWKNLKTGTTLGGDLKAAIERDFGSVEKFQEEFEKA
AATRFGSGWAWLVLKDGKLAVVSTANQDSPLMGEAVAGASGFPIIGLDVWEHAYYLKYQN
KRPDYIKAFWNVVNWDEAAARFAAKK
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgagttattcactgccatccctgccttacgcttacgacgcactggaaccgcatttcgac
aagcagacgatggaaatccatcacaccaaacaccaccagacctacgtcaacaacgccaac
accgtgctggaagcctaccctgagctggccaaatacagcgttgaagagctgatccaggat
ctggataaagtgcctgccgacaaacgcaccttcatgcgtaacaacgccggcggccacgcc
aaccacagcttcttctggaaaaacctgaaaaccggcaccacgctgggcggcgatctgaaa
gcggccatcgagcgcgatttcggcagcgttgagaaattccaggaagagttcgagaaagcc
gcagccacccgcttcggttccggttgggcctggctggtgctgaaagacggcaagctggcc
gtagtgtctaccgccaaccaggacagcccgctgatgggcgaagccgtcgccggcgcttcc
ggtttcccaatcatcggcctggacgtgtgggaacacgcttactacctgaaatatcagaac
aaacgtcctgactacatcaaggcgttctggaacgtggtcaactgggacgaagccgccgcg
cgcttcgccgcgaagaagtaa

DBGET integrated database retrieval system