KEGG   Serratia marcescens WW4: SMWW4_v1c01380Help
Entry
SMWW4_v1c01380    CDS       T02448                                 

Definition
(GenBank) MarR family transcriptional regulator
Organism
smw  Serratia marcescens WW4
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MarR MarR_2 HTH_27 HTH_34 Penicillinase_R TFIIE_alpha HxlR PadR HTH_20 HTH_24 Fe_dep_repress TrmB HTH_micro
Motif
Other DBs
NCBI-ProteinID: AGE15946
LinkDB All DBs
Position
144151..144615
Genome map
AA seq 154 aa AA seqDB search
MKSTDTAQPNAKNLLQLDQQLCFALYSANLALHKVYRKLLNQLELTYPQYLVMMVLWERD
RVTVSDIGERLFLDSATLTPLLKRLETAGLLVRYRATTDERQVIIALTEAGRALRERAQS
VPEAVMCATDCSLDEIVSLKQQLEKLRGSLIDQI
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagcaccgataccgcacaacccaacgcgaagaacctgctgcagctcgatcagcag
ctctgtttcgcgctgtactccgccaacctggcgctgcacaaagtctaccgcaagctgttg
aatcagctcgaactcacctacccgcaatacctggtgatgatggtgctgtgggagcgcgat
cgggtgacggtatcggatatcggcgagcggctgttcctcgattccgccacgctgacgccg
ctgctgaagcggctggaaaccgccggtttgctggtgcgctatcgcgccaccaccgacgag
cggcaggtgatcattgccctcaccgaagccggccgcgcgctgcgtgagcgggcgcaatcg
gtgcccgaggcggtgatgtgcgccaccgactgcagcctggacgagatcgtctcgctcaaa
cagcagttggaaaagctgcgcggcagcctgatcgatcagatttga

DBGET integrated database retrieval system