KEGG   Serratia marcescens WW4: SMWW4_v1c02730Help
Entry
SMWW4_v1c02730    CDS       T02448                                 

Gene name
tuf1
Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
smw  Serratia marcescens WW4
Brite
Translation factors [BR:smw03012]
 Eukaryotic Type
  Elongation factors
   SMWW4_v1c02730 (tuf1)
 Prokaryotic Type
   SMWW4_v1c02730 (tuf1)
Mitochondrial biogenesis [BR:smw03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    SMWW4_v1c02730 (tuf1)
Exosome [BR:smw04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   SMWW4_v1c02730 (tuf1)
  Exosomal proteins of breast cancer cells
   SMWW4_v1c02730 (tuf1)
  Exosomal proteins of colorectal cancer cells
   SMWW4_v1c02730 (tuf1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 Lsm_C cobW
Motif
Other DBs
NCBI-ProteinID: AGE16080
LinkDB All DBs
Position
304232..305416
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGSARAFDQIDNAPEEKARG
ITINTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPFIIVFMNKCDMVDDEELLELVEMEVRELLSAYDFPGDDLPVIRGSALKALE
GEAEWEAKIIELAEALDSYIPEPERAIDKPFLLPIEDVFSISGRGTVVTGRVERGIIKVG
EEVEIVGIKDTVKSTCTGVEMFRKLLDEGRAGENVGVLLRGIKREEIERGQVLAKPGSIK
PHTQFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNVNMV
VTLIHPIAMDDGLRFAIREGGRTVGAGVVAKVIA
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagaaaagtttgaacgtacaaaaccgcacgttaacgtcggtactatcggccac
gttgaccacggtaaaactaccctgactgcagcgatcactaccgtactggctaaaacctac
ggcggttctgcacgtgctttcgaccagatcgataacgcgccagaagaaaaagctcgtggt
atcaccatcaacacctcccacgttgagtatgacaccccgactcgtcactacgcgcacgtt
gactgcccagggcacgccgactacgtgaaaaacatgatcaccggtgctgctcagatggac
ggcgcgatcctggtagtagctgcgactgacggcccaatgcctcagactcgtgagcacatc
ctgctgggtcgtcaggttggcgttcctttcatcatcgtattcatgaacaaatgcgacatg
gttgatgatgaagagctgctggaactggtagaaatggaagttcgcgaactgctgtccgct
tacgacttcccaggcgacgacctgccagtaatccgcggttccgcgctgaaagcgctggaa
ggcgaagctgagtgggaagcgaaaatcatcgaactggccgaagccctggacagctacatc
ccagagccagagcgtgcaatcgacaagccgttcctgctgccaatcgaagacgtattctcc
atctccggtcgtggtaccgttgttaccggtcgtgttgagcgcggtatcatcaaagttggc
gaagaagttgaaatcgttggtatcaaagacaccgttaagtctacctgtactggcgttgaa
atgttccgcaaactgctggacgaaggccgtgctggtgagaacgtaggtgttctgctgcgt
ggtatcaaacgtgaagaaatcgaacgtggtcaggtactggctaagccaggctccatcaag
ccgcacacccagttcgaatctgaagtgtacatcctgagcaaagatgaaggtggtcgtcac
acgccattcttcaaaggctaccgtccacagttctacttccgtactactgacgtgaccggt
accatcgaactgccagaaggcgtagagatggtaatgccaggcgacaacgtgaacatggtt
gtaaccctgattcacccaatcgcgatggatgacggtctgcgtttcgcaatccgtgaaggc
ggccgtactgtaggcgctggtgttgttgctaaagttatcgcttaa

DBGET integrated database retrieval system