KEGG   Serratia marcescens WW4: SMWW4_v1c05920Help
Entry
SMWW4_v1c05920    CDS       T02448                                 

Gene name
ampH
Definition
(GenBank) penicillin-binding protein
  KO
K18988  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase [EC:3.4.16.4 3.4.21.-]
Organism
smw  Serratia marcescens WW4
Brite
KEGG Orthology (KO) [BR:smw00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:smw01002]
    SMWW4_v1c05920 (ampH)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:smw01011]
    SMWW4_v1c05920 (ampH)
Enzymes [BR:smw01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     SMWW4_v1c05920 (ampH)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     SMWW4_v1c05920 (ampH)
Peptidases and inhibitors [BR:smw01002]
 Serine peptidases
  Family S12: D-Ala-D-Ala carboxypeptidase B family
   SMWW4_v1c05920 (ampH)
Peptidoglycan biosynthesis and degradation proteins [BR:smw01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   SMWW4_v1c05920 (ampH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta-lactamase Peptidase_S11
Motif
Other DBs
NCBI-ProteinID: AGE16399
LinkDB All DBs
Position
complement(666789..667931)
Genome map
AA seq 380 aa AA seqDB search
MKNSVSALLLALGLCAAPLAVQAAPPQLASQIVDQYAEHIFYNSGATGMALVVIDGNQVV
NRSFGDTKPGNNLRPRPDSLIRIASITKLMTSEVMVKMAAAGQVKLTDPLRKYAPKGAYV
PSYNAGQPITLLNLATHTSALPREQPGKKPPKTPVFTWPTKAQRWQWLAHANVTVPPGVR
AAYSNLAYDLLADALSRAAGKPYSALLKEKITAPLGMVDTTLTPSPEQCSRLMVAAAGPS
ACRDTTAAAGSGGVYSTPRDMQRWMQQFLSSSASGPRKATAASEQTMYFQRHDLVSLKGM
DVPGQADALGLGWVYMAPKDGLPGIIQKTGGGGGFITYMAMIPAKNVGVFVVVTRSELSK
FTNMSDPVNRLVSDLAANKS
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
ttgaagaactctgtctccgctttattgctggcgctgggcctgtgcgccgcgccgctggcc
gtgcaggccgcgcccccgcagctggcttcgcaaatcgtcgaccagtatgccgaacatatt
ttctacaacagcggcgccaccggcatggcgctggtggtgatcgacggcaatcaggtggtt
aaccgcagcttcggcgacaccaagcccggcaacaacctgcgcccgcgcccggattcgctg
atccgcatcgcctcgatcaccaagctgatgaccagcgaagtgatggtgaaaatggcggcg
gcaggccaggtcaagctgaccgacccgctgcgcaagtacgctcccaagggcgcctatgtg
ccgtcttacaacgccggccagccgatcacgttattaaacctggcgacccacaccagcgcg
ttgccgcgcgagcagccgggcaaaaagccgccgaaaacgccggtattcacctggccgacc
aaggctcagcgctggcaatggctggcgcatgccaacgtcacggtgccgccgggcgtgcgc
gccgcgtattccaacctggcgtacgatctgctggccgacgcgctctcgcgcgccgcgggc
aagccttacagcgcgctgctgaaagagaaaatcaccgcgccgctcggcatggtcgacacc
acgttgacgccgagccccgaacagtgctcgcgcctgatggtggcggcggccggcccgagc
gcctgtcgcgacaccaccgccgcggccggcagcggcggcgtctactccaccccgcgcgac
atgcagcgctggatgcagcagttcctctcttccagcgccagcggcccgcgcaaagccacc
gccgccagcgagcaaaccatgtacttccagcgccacgatctggtgtcgctgaagggcatg
gacgtgccgggacaagcggatgcattgggattgggctgggtgtatatggcgccgaaggac
gggctgccgggcatcattcagaagaccggcggcggcggcggattcattacctacatggcg
atgatcccggcgaaaaacgtcggggtgttcgtggtggtgacccgttcggagctgagcaag
ttcaccaacatgagcgatccggtcaaccgcctggtgagcgatctggcggccaacaagagt
tga

DBGET integrated database retrieval system