KEGG   Serratia marcescens WW4: SMWW4_v1c14370Help
Entry
SMWW4_v1c14370    CDS       T02448                                 

Gene name
yncG
Definition
(GenBank) putative glutathione S-transferase
  KO
K11208  GST-like protein
Organism
smw  Serratia marcescens WW4
Brite
KEGG Orthology (KO) [BR:smw00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99975 Protein processing
    SMWW4_v1c14370 (yncG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_3 AAA_25 GST_C_2
Motif
Other DBs
NCBI-ProteinID: AGE17241
LinkDB All DBs
Position
1575848..1576504
Genome map
AA seq 218 aa AA seqDB search
MHDTYTLFGTQGCGSTIVAAALALTAFPWGYEEVDYTQDGPERDRLLALNPLGQVPTLVL
PNDEVMTESAAIILLLHDRAPHAELAPPGGSPLLPRFLRWLLFINAEIYPTFTYADHPQR
WQPQAAGAEQLKNAVMDYRERLLRQLNAAAGASGPWFLGKSFSALDLYVAVMCNWRPGRA
WFRQHCPRLYAIAERVERRPELNALLSAHFDGVASLEP
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgcacgatacttatactttgttcggtacgcagggctgcggttcgaccatcgtggccgcc
gcgttggcgttgactgctttcccctggggctatgaggaggtggattacacgcaggacggc
ccggaacgcgatcgcctgttggcgctgaacccgctgggtcaggtgcccaccttagtgctg
cccaatgacgaagtgatgacggagagtgcggcgattatcctgctgctgcacgatcgcgcg
ccgcatgccgagctggcgccgcccggcggttcgccgctgttgccgcgttttctgcgctgg
ctgctgttcatcaacgcggagatttaccccaccttcacctatgccgaccatccgcagcgc
tggcagccgcaggcggcaggggcggaacagctgaaaaacgcggtaatggattatcgtgag
cgtttattgcggcagttgaacgccgccgcaggggcgtctggcccgtggtttctcggcaag
agcttcagcgcgttggatctgtacgtggcggtaatgtgcaactggcggccgggccgcgcg
tggttccggcaacactgcccgcggctttacgccattgccgaacgggtggagcggcggccg
gagctgaatgcgctgctgagcgcccatttcgacggcgttgcctcgctggaaccgtga

DBGET integrated database retrieval system