KEGG   Serratia marcescens WW4: SMWW4_v1c16080Help
Entry
SMWW4_v1c16080    CDS       T02448                                 

Gene name
gstB
Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
smw  Serratia marcescens WW4
Pathway
smw00480  Glutathione metabolism
smw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smw00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SMWW4_v1c16080 (gstB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:smw02000]
    SMWW4_v1c16080 (gstB)
Enzymes [BR:smw01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     SMWW4_v1c16080 (gstB)
Transporters [BR:smw02000]
 Other transporters
  Pores ion channels [TC:1]
   SMWW4_v1c16080 (gstB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_2 GST_C Tom37 GST_N_4 GST_C_3
Motif
Other DBs
NCBI-ProteinID: AGE17412
LinkDB All DBs
Position
complement(1769958..1770578)
Genome map
AA seq 206 aa AA seqDB search
MLTIWGRENSNNVRKVLWCAAELGLSYTHINAGGAFGKVNEESYRALNPNGLVPLLQDDD
FVLWESNTIVRYLAAKFGDATFYPQDLQARAAAEKWMDWTTSTIVPAFTIVFWGLIRTAP
ELRDMAKIEAAIATLEKHFDVIEQTLAHQPYLSGGAFGFGDIPLGSFAYAWFEMPIARRP
RPNMERWYQQLHARPAYQRGVMSALT
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgctgaccatttggggtcgtgagaattcgaacaacgtcaggaaggtgctgtggtgcgcc
gccgaactggggctgagctatacccacatcaacgccggcggggcgtttggcaaggtcaac
gaagagagttaccgcgcgctgaacccgaacggcctggtgccgttactgcaggacgatgac
ttcgtgctgtgggagtccaacaccatcgtgcgctacctggcggcgaaattcggcgacgcg
acgttctatccgcaagatctgcaggcgcgcgccgccgccgagaaatggatggactggacc
acctcgaccatcgttccggccttcaccatcgtcttttggggcctgatccgcactgcgcca
gagttgcgcgacatggcgaaaatcgaagcggcgatcgccacgctggaaaaacacttcgac
gtcatcgaacagacgctggcgcaccagccttacctctccggcggcgcgttcggtttcggc
gatatcccgctcggcagcttcgcctacgcctggttcgaaatgccgatcgctcgccgccca
cggccgaacatggagcgctggtatcagcagctgcacgcacgcccggcctaccagcgcggc
gtgatgagcgcactcacctga

DBGET integrated database retrieval system