KEGG   Serratia marcescens WW4: SMWW4_v1c27000Help
Entry
SMWW4_v1c27000    CDS       T02448                                 

Gene name
ydjJ
Definition
(GenBank) putative Zn-dependent and NAD(P)-binding oxidoreductase
  KO
K05351  D-xylulose reductase [EC:1.1.1.9]
Organism
smw  Serratia marcescens WW4
Pathway
smw00040  Pentose and glucuronate interconversions
smw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SMWW4_v1c27000 (ydjJ)
Enzymes [BR:smw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.9  D-xylulose reductase
     SMWW4_v1c27000 (ydjJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C UDPG_MGDP_dh_N Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AGE18495
LinkDB All DBs
Position
2928337..2929371
Genome map
AA seq 344 aa AA seqDB search
MKALVLAKAGEIAIEDVQLAETLGPDDVQIKIHSVGICGSDVHYYQHGRIGPFVVNAPMV
LGHEASGVVLATGKNVTHLSVGDRVCMEPGIPDLNSTQTRAGIYNLDPAVRFWATPPVHG
CLRETVIHPAAFTFKLPDNVSFAEGAMVEPLAIGMQAATKAGIKPGDIALVIGAGPIGVV
TALAALAGGCSDVIICDLFDEKLAVAASYEGLHAVNIKTGDLAGKVAALTSGNGADVVFE
CSGAKPAIATLAEHAAPGATAVLVGMPIDAAPMDIVAAQAKEITFKTIFRYANMYPRTLR
LLSSGKLRVQPLISQTYKFSDSVAAFERAAAGHASDIKIMLEME
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattagtgttggccaaagcgggggaaatcgctattgaggacgtccagcttgcc
gaaacgctggggcccgatgatgtgcagataaaaattcattccgtgggcatctgcggcagt
gatgtgcactattaccaacatggccgcattggcccgttcgtggttaacgccccgatggtg
ctcggccatgaagcttctggcgtggtgctcgcgacaggtaaaaacgtcactcacctcagc
gtcggcgatcgcgtttgcatggaacccggcattccggatctcaactcgacgcagacgcgc
gccggcatttacaaccttgacccggccgtgcgcttctgggcgacgccgccggtgcacggc
tgcctgcgcgaaaccgtcatccaccccgccgccttcacgttcaaattgccggacaacgtc
agtttcgccgaaggcgccatggtggaacccttagccatcggcatgcaagcagccaccaaa
gccgggatcaaacccggcgatatcgcgctggtgatcggcgccgggccgatcggcgtggtc
accgctctcgcggcgctggcgggcggctgctcggacgtcattatttgcgacctgtttgac
gaaaaactcgccgttgcggccagttatgaggggctgcacgccgtcaatatcaaaaccggc
gacctggcggggaaagtggccgcgctcaccagcggcaatggcgccgatgtcgtgtttgaa
tgcagcggcgcaaaaccggccatcgctacgctggccgaacatgcggcgccaggagcgacc
gccgtgctggtcggcatgccgatcgatgccgcgccgatggatatcgtcgccgcgcaggcc
aaggaaatcaccttcaagaccattttccgctacgccaacatgtacccgcgcacgctgcgg
ctgttgagcagcggcaaattgcgcgtccagccgttgataagccaaacctacaagttctcc
gacagcgtggccgccttcgagcgcgcggcggcgggacatgcctcggacatcaaaatcatg
ctggaaatggagtga

DBGET integrated database retrieval system