KEGG   Serratia marcescens WW4: SMWW4_v1c32930Help
Entry
SMWW4_v1c32930    CDS       T02448                                 

Gene name
yiaR
Definition
(GenBank) putative L-xylulose 5-phosphate 3-epimerase
  KO
K03079  L-ribulose-5-phosphate 3-epimerase [EC:5.1.3.22]
Organism
smw  Serratia marcescens WW4
Pathway
smw00040  Pentose and glucuronate interconversions
smw00053  Ascorbate and aldarate metabolism
smw01100  Metabolic pathways
smw01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:smw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SMWW4_v1c32930 (yiaR)
   00053 Ascorbate and aldarate metabolism
    SMWW4_v1c32930 (yiaR)
Enzymes [BR:smw01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.22  L-ribulose-5-phosphate 3-epimerase
     SMWW4_v1c32930 (yiaR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2 Methyltrans_RNA
Motif
Other DBs
NCBI-ProteinID: AGE19087
LinkDB All DBs
Position
complement(3551843..3552712)
Genome map
AA seq 289 aa AA seqDB search
MQTTNAACLGLYEKALPADLGWPQRLATAAELGFEFVEMSIDEQPARQQRLDWDRRQRLA
FIQARLDSGVTVPSLCLSAHRRDPFGSADAATRERARVLMSKALELATDLGIRNIQLAGY
DVYYEPADRHSRERFIEGMQWAAAQAARAQVMLSVEVMDTPFINSISKWRDIARHVNSPW
FTVYPDLGNLSAWGNDVAAELTLGIGSITAVHLKDTVAVGPGSAGQFRDVPFGEGCVDFA
HAFSVLNALGYRGPYLLEMWAREDGQDKQRIAQAKAWLEQQMNDGGIAC
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacgactaacgccgcctgtctggggctgtatgaaaaggcgctgcccgccgatctg
ggctggccgcagcggctggccaccgccgccgagctgggctttgagttcgtggagatgtcg
atcgacgaacagccggcacgccagcagcggctggactgggatcgccgccagcggctggcg
tttatccaggcgcggctcgacagcggggtgacggtgccgagcctgtgcctgtcggcgcac
cggcgcgatccgttcggcagcgccgacgccgccacccgcgagcgggcgcgggtgttgatg
agcaaggcgctggaactggcgacggatctcggcatccgcaacatccagctggcgggttac
gacgtctattacgaaccggccgatcgccacagccgcgagcgctttatcgagggcatgcag
tgggcggcggcgcaggctgccagggcgcaggtgatgctgtcggtggaggtgatggatacg
ccgttcatcaacagcatcagcaaatggcgcgacatcgcccgccacgtcaacagcccgtgg
ttcacggtgtatcccgatctcggcaaccttagcgcctggggcaacgacgtcgccgccgag
ctgacgctgggcatcggcagcatcaccgccgtgcacctcaaagacaccgtggcggtgggg
ccgggcagcgccgggcagttccgcgacgtgccgttcggcgaaggctgcgtggatttcgcc
catgccttttccgtgctcaacgcgctcggctatcgcggcccctacctgctggagatgtgg
gcgcgcgaagacgggcaggacaagcaacgtatcgcccaggccaaggcctggctcgaacaa
cagatgaatgatggaggcatcgcatgctga

DBGET integrated database retrieval system