KEGG   Serratia marcescens WW4: SMWW4_v1c45930Help
Entry
SMWW4_v1c45930    CDS       T02448                                 

Gene name
glpD
Definition
(GenBank) FAD/NAD(P)-binding sn-glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
smw  Serratia marcescens WW4
Pathway
smw00564  Glycerophospholipid metabolism
smw01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:smw00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    SMWW4_v1c45930 (glpD)
Enzymes [BR:smw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     SMWW4_v1c45930 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 NAD_binding_8 Pyr_redox_2 FAD_oxidored 3HCDH_N Lycopene_cycl GIDA HI0933_like
Motif
Other DBs
NCBI-ProteinID: AGE20380
LinkDB All DBs
Position
4962951..4964459
Genome map
AA seq 502 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLLLEAQDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKLAPHIAFPMRFRLPHQPHLRPAWMIRIGLFLYDHLGKRTSLPGS
KGLRFGPESVLKPELKRGFEYSDCWVDDARLVVLNAQEVEKRGGEVRTRTKVTRAWRENG
LWMVEAVDIDSGKTFTWRAKGLVNATGPWVKNFFDDGLKLKSPYGIRLIKGSHIVVPRVH
DQPQSYILQNEDHRIVFVIPWNDEFSIIGTTDVEYKGDPKDVKIDENEIAYLLKVYNDHF
KKQLGRDDIVWTYSGVRPLCDDESDSPQAITRDYTLDVHDEQGKAPLLSVFGGKLTTYRK
LAEHAMEKLAHYYPGCGPAWTKNATLPGGDIDGDRDGYAAKLRRAHGWLPEALARRYART
YGSQSELILAGANGLADLGEDFGHGLYEAELRYLTEKEWVVELDDAIWRRTKLGMWLDEA
QQARVKAWLAEHAKTKALSLAS
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaccaaagacttgatcgttatcggtggcggcatcaacggtgccggcatcgcggcg
gatgctgccgggcgcgggctgtcggtactgctactggaagcgcaagacttggcctgtgct
acgtcttccgccagttccaaactgatccacggtggcctgcgctacctggaacactacgaa
ttccgtctggtgagcgaagcgctggccgaacgtgaagtgctgctgaaactggcgccacac
atcgcgttcccgatgcgtttccgcctgccgcaccagccgcacctgcgtccggcctggatg
atccgcatcggcctgttcctgtacgatcacctgggcaaacgcaccagcctgccgggcagc
aagggtttgcgctttggaccagagtcggtgctgaagcctgaactgaagcgcggtttcgaa
tattccgactgctgggtcgacgatgctcgcctggtggtgctgaacgcgcaggaagtggaa
aaacgcggcggcgaagtgcgcacccgcaccaaagtgacccgcgcatggcgtgaaaacggc
ctgtggatggtggaagcggtcgatatcgacagcggcaaaaccttcacctggcgcgccaaa
ggcctggtgaacgccaccggcccgtgggtgaaaaacttcttcgacgacggcctgaagctg
aaatcgccttacggcatccgcctgatcaaaggcagccacatcgtggtgccgcgcgtgcac
gatcagccgcagtcttacattctgcagaacgaagaccaccgcatcgtgttcgtgatcccg
tggaatgacgagttctccatcatcggcaccaccgacgtggagtacaaaggcgatccgaaa
gacgtgaagatcgacgagaacgaaatcgcttatctgctgaaagtgtacaacgatcacttc
aagaagcagctgggccgcgacgacatcgtctggacttactccggcgtgcgtccgctgtgc
gacgacgaatccgattcaccgcaggcgatcacccgcgattacacgctggacgtgcacgac
gagcagggcaaggcgccgctgctgtcggtgttcggcggcaagctgaccacctaccgcaag
ctggccgaacatgcgatggaaaaactggcccactactacccaggctgcggcccggcgtgg
accaaaaatgccacgctgccgggcggtgacatcgacggcgaccgcgacggttacgcggcc
aaactgcgccgtgcgcacggctggctgccggaagccctggcgcgccgctatgcccgcacc
tacggcagccagagcgagctgatcctggccggcgccaacggcctcgccgatctgggcgaa
gatttcggccacggtctgtatgaagccgagctgcgctacctgaccgagaaagagtgggtc
gtagagctggacgacgccatctggcgccgcaccaagctgggcatgtggctggacgaagcg
cagcaggcgcgagtgaaagcctggctggcggaacacgcgaaaacgaaagcgctgtctttg
gcttcctga

DBGET integrated database retrieval system