KEGG   Sinorhizobium meliloti SM11: SM11_chr0093Help
Entry
SM11_chr0093      CDS       T01885                                 

Definition
(GenBank) hypothetical protein
Organism
smx  Sinorhizobium meliloti SM11
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IalB
Motif
Other DBs
NCBI-ProteinID: AEH77380
UniProt: F7X6H4
LinkDB All DBs
Position
105854..106423
Genome map
AA seq 189 aa AA seqDB search
MGRLTGGLAAVTGFILSAGASVGQEGETAPRYRIKPSEVAVPPDVPIGMYRRVIHPFGNW
TLICDENFKTKQKICNITQNVADESGKSIFSWSLAATAEGRPMMILRVPPAAGKGSRVSL
SFPDRKKPVEVEVESCDRGVCLATVPVGPILRDNIAREATVGVSYGTGDGTISINLPLKG
LNPALEAIE
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggggcgcctcaccggcggcctggcggccgtcaccggtttcatcctgtctgccggcgcc
tccgtcggacaggagggggagacggcccctcgctaccggataaagccctccgaggtggcc
gttccgcccgatgtgccgatcggaatgtatcgccgcgtcatccatcctttcggaaactgg
acgctcatttgcgacgagaatttcaagacgaagcagaagatctgcaacatcacgcaaaac
gtcgccgacgagtccggaaaaagcattttcagctggtcgctcgccgcaaccgcggaaggc
aggccgatgatgatcctgagggtgcctccggccgccggcaaggggtcgagagtgagcctt
tcgttccccgaccgcaagaagccggtcgaggtggaggtggaaagctgcgaccgcggcgtc
tgcctggcgacggtgccggtaggccccatcctgcgtgacaacatcgcccgggaggcgacg
gtcggggtctcctacggcacgggcgacggaaccatcagcatcaacctgcctctgaagggc
ctgaacccggcactggaggccatagagtag

DBGET integrated database retrieval system