KEGG   Sinorhizobium meliloti SM11: SM11_chr0830Help
Entry
SM11_chr0830      CDS       T01885                                 

Definition
(GenBank) probabable aldehyde dehydrogenase protein
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
smx  Sinorhizobium meliloti SM11
Pathway
smx00010  Glycolysis / Gluconeogenesis
smx00620  Pyruvate metabolism
smx01100  Metabolic pathways
smx01110  Biosynthesis of secondary metabolites
smx01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:smx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SM11_chr0830
   00620 Pyruvate metabolism
    SM11_chr0830
Enzymes [BR:smx01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     SM11_chr0830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AEH78108
UniProt: F7X1D2
LinkDB All DBs
Position
868908..870416
Genome map
AA seq 502 aa AA seqDB search
MLHQKIVENPYKQKYGNFIGGEWREPVAGRYFDNTTPITGGTLCEVARSDAADIEIALDA
AHAAREKWGRTSTTERSNILMKIAARMEDNLELLARAETWDNGKPIRETMAADIPLAIDH
FRYFAACIRAQEGSIGEIDHDTVAYHFHEPLGVVGQIIPWNFPILMAAWKLAPALAAGNC
VVLKPAEQTPGSILVWAELIGDLLPPGVLNIVNGFGLEAGKPLATSPRIAKIAFTGETTT
GRLIMQYASQNLIPVTLELGGKSPNIFFADVASEDDDFFDKALEGFAMFALNQGEVCTCP
SRALVQESIYDRFMERAVKRVEAIRQGNPLDEATMIGAQASSEQLEKILAYIEIGKEEGA
EVLTGGGRNVLEGDLSGGYYVKPTVFHGHNRMRIFQEEIFGPVVSVTTFKTEAEALEIAN
DTLYGLGAGVWSRDANRCYRFGRAIEAGRVWTNCYHAYPAHAAFGGYKQSGIGRETHKMM
LDHYQQTKNMLVSYSPKALGFF
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgctgcatcagaagatcgtcgagaacccctacaagcagaaatacgggaacttcatcggc
ggcgaatggcgcgaacccgttgcaggccgctatttcgacaacacgacgccgatcaccggc
ggcacgctttgcgaggtcgcgcgttcggacgccgccgacatcgagatcgccctcgacgcg
gcgcacgccgcaagggagaaatggggccggacctcgacgacggagcggtcgaacattctg
atgaagatcgccgcccgcatggaggacaatctggagcttctggcacgggcggaaacctgg
gacaacggcaagccgatccgcgagacgatggccgccgacattccgctggcgatcgatcat
ttccgctatttcgcggcctgcatccgtgcacaggaaggctcgatcggcgagatcgaccac
gacaccgtcgcctaccatttccacgagccgctcggcgtcgtcggccagatcattccctgg
aacttcccgatcctgatggccgcctggaagcttgcgccggcgcttgccgccggaaactgc
gtcgtgctgaagccggccgagcagacgccgggctcgatcctcgtctgggcggaactcatc
ggtgacctcctgccgccgggtgtcctcaacatcgtcaacggcttcggcctcgaagcgggc
aagccgctcgccaccagcccgcgcatcgccaagatcgcttttaccggcgagacgacgacc
gggcggctgatcatgcaatatgccagccagaacctcatcccggtcacgctggagctcggc
ggaaagtcgccgaacatcttcttcgcggacgtcgccagcgaggacgacgacttcttcgac
aaggcgctggaaggcttcgccatgttcgcgctgaaccagggcgaggtctgcacctgcccg
agccgggcactggtacaggagagcatctacgaccgcttcatggagcgggcggtaaagagg
gtcgaggcgatccggcagggcaatccgctcgatgaagcaaccatgatcggcgcccaggct
tcgagcgaacagctcgagaaaatcctcgcctatatcgaaatcggcaaggaggaaggtgcc
gaggtgctgaccggcggcgggcgcaacgtgctcgaaggcgatctttccggcggctactac
gtcaagccgaccgtattccacggccacaacaggatgcgcatctttcaggaggagattttc
gggccggtcgtgtcggtcacgaccttcaagacggaagccgaggcgctggaaatcgccaac
gacacgctctacgggcttggcgccggcgtgtggagccgcgatgccaaccgctgctaccgc
ttcggccgcgcgatcgaagccggccgggtctggaccaattgctaccacgcctatccggcg
cacgccgccttcggcggttacaagcagtccggcatcgggcgcgagacgcacaagatgatg
ctggatcactatcagcagacgaagaacatgctggtcagctacagcccgaaggctctcggc
ttcttctga

DBGET integrated database retrieval system