KEGG   Sinorhizobium meliloti SM11: SM11_chr2537Help
Entry
SM11_chr2537      CDS       T01885                                 

Gene name
alr
Definition
(GenBank) Alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
smx  Sinorhizobium meliloti SM11
Pathway
smx00473  D-Alanine metabolism
smx01100  Metabolic pathways
smx01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:smx00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    SM11_chr2537 (alr)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    SM11_chr2537 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:smx01011]
    SM11_chr2537 (alr)
Enzymes [BR:smx01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     SM11_chr2537 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:smx01011]
 Precursor biosynthesis
  Racemase
   SM11_chr2537 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AEH79790
UniProt: F7X514
LinkDB All DBs
Position
2506912..2508090
Genome map
AA seq 392 aa AA seqDB search
MYCCRYRPRRVFGMQSPEFLSASSRLTVDLTALADNWRAMNERSGKARAAAVLKADAYGL
GVVHAAPALYAAGARDFFVASVEEGADLRPLVPDGRIYILAGMWPGNEELFFENDLVPII
NSEEQLAVFMAALSERGDHPCVLHVDTGMNRLGLSPEEALALAHDPARPASFSPVLVMSH
LACADDPGHPMNRYQLQRFREVTAAFEGVPASLANSGGVFLGADYHFDLTRPGIAVYGGE
AVNGAVNPMKAVVTAEARIVQVRTVPSGGTASYGASVRFGRDSRIATVAIGYADGYHRSV
SGGGVTLRQAMPSGAFGFLHGMKVPHVGRVTMDLSLFDVTDLPEAAVRAGDYIEVFGRNV
VIDDVARAGGTIGYELLTSLGRRYHRTYVGGA
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgtattgctgccgatatcgcccacgcagagttttcggtatgcaaagccccgagtttctt
tccgcctccagcaggctcaccgtcgacctcaccgcgctcgccgacaattggcgggcgatg
aacgagcggtccggaaaagcccgcgccgccgccgttctgaaggccgatgcctacggtctc
ggcgtcgtgcatgccgctccggctctctatgccgccggcgcgcgcgatttcttcgtggcc
agtgtcgaagaaggggccgatcttcgcccgcttgttccggatgggcgaatctacattctc
gcgggaatgtggcccggcaacgaggagctcttcttcgagaacgatctcgtgccgatcatc
aactcggaagagcagctggcggtcttcatggcagcgctttccgaacggggcgaccacccc
tgcgttctccacgtcgacacgggcatgaaccggctcggcctgtcgcctgaggaggcgctt
gccctcgcccacgaccctgcgcggcctgcgagtttctcgccggtcctcgtcatgagccat
ctggcctgcgccgacgatcccggacacccgatgaaccgctatcagcttcagcgtttccgc
gaggtgaccgccgccttcgagggcgtgccggcgagccttgcaaattccggcggcgtgttc
ctcggtgcggactaccacttcgacctcacccggcccggcatcgcggtctatggcggcgag
gcggtaaatggcgcggtcaatccgatgaaagcggtcgtcaccgccgaagcgcgcatcgtg
caggtcaggacggttccatccggcggaacggcaagctacggcgcctcggtccgcttcggc
cgcgacagccgcattgcgacggtcgcgatcggctatgccgacggctaccaccgttcggtt
tcgggcggcggcgtcaccctcagacaggcgatgccctcgggcgccttcggtttcctgcat
ggtatgaaggtgccgcatgtcggtcgggtgacgatggatctgagcctgttcgatgtcacg
gacctgccggaagcggccgtacgtgccggcgattatatcgaggtcttcgggcgcaatgtc
gtcatcgacgacgtcgcgcgcgccggcggtaccatcggctacgagctgctgacgagcctc
ggccggcgctatcatcggacctatgtcggaggcgcttga

DBGET integrated database retrieval system