KEGG   Sinorhizobium meliloti SM11: SM11_chr2772Help
Entry
SM11_chr2772      CDS       T01885                                 

Gene name
ptsP
Definition
(GenBank) phosphoenolpyruvate phosphotransferase PTSP (enzyme I-Ntr) protein
  KO
K08484  phosphotransferase system, enzyme I, PtsP [EC:2.7.3.9]
Organism
smx  Sinorhizobium meliloti SM11
Pathway
smx02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:smx00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    SM11_chr2772 (ptsP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:smx02000]
    SM11_chr2772 (ptsP)
Enzymes [BR:smx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.3  Phosphotransferases with a nitrogenous group as acceptor
    2.7.3.9  phosphoenolpyruvate---protein phosphotransferase
     SM11_chr2772 (ptsP)
Transporters [BR:smx02000]
 Phosphotransferase system (PTS)
  Enzyme I and HPr
   Enzyme I [TC:8.A.7]
    SM11_chr2772 (ptsP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP-utilizers_C PEP-utilisers_N GAF_2 PEP-utilizers GAF GAF_3 SpoVT_C
Motif
Other DBs
NCBI-ProteinID: AEH80019
UniProt: F7X6Y4
LinkDB All DBs
Position
complement(2748614..2750881)
Genome map
AA seq 755 aa AA seqDB search
MRDLSAGPRVLLKRLRELMAEPLEPQERLDRIVRQIAQNMVAEVCSVYVLRSDGVLELYA
TEGLNKTAVHLAQLKMGQGLVGTIAASARPLNLSDAQSHPAFTYLPETGEEIYHSFLGVP
ILRTGRALGVLVVQNKAQRNYREDEVEALETTAMVLAEMVATGELKKITKPGLELDLSRP
VTIEGNSYGEGIGLGYVVLHEPRIVVTNLLNEDTEHELQRLAEALGSLRISIDDMLSRRD
VSMEGEHRAVLETYRMFAHDRGWVRKLEEAIRNGLTAEAAVERVQSETKARMIRLTDPYL
RERMHDFDDLANRLLRQLSGYGAKLSAADFPNDAIVVARAMGAAELLDYPRENVRGLVLE
EGAVTSHVVIVARAMGIPVVGQAAGAVALAENRDAIIVDGDDAKVHLRPMADLQRAYEEK
VRFRARRQAQFRALRDVEPLTKDGKRITLQMNAGLLVDLPHLNEAGAEGIGLFRTELQFM
IASTMPKAEEQEAFYRNVMKQTAGKPVTFRTLDIGGDKVVPYFRAAEEENPALGWRAIRL
SLDRPGLLRTQFRAMLRATAGAELKMMLPMVTEVAELKSARELLQKEIERQSKLGEQLPR
KLQFGAMLEVPALLWQLDELMAEVDFVSVGSNDLFQFAMAVDRGNARVSERFDILGRPFL
RILREIVRAGERNNTPVTLCGEMASKPLSAMALLGLGFRSVSMSPTAVGPVKAMLLALDA
GRLNELLEAALDDVKSDTSIRQLLVDFAAANGIPV
NT seq 2268 nt NT seq  +upstreamnt  +downstreamnt
atgagagacctttccgcaggtccgcgcgttctcctcaagcggttgcgcgagctcatggcg
gaaccgctcgagccgcaggagcgccttgaccggatcgttcgccagattgcgcagaacatg
gttgcggaagtgtgctcggtttacgtgctgcgctccgatggcgtgctcgaactttacgcg
accgaaggtctgaacaagacggcggtgcatctggcgcaattgaagatgggacagggtctc
gtcggtacgatcgccgcttcggcacggccgctcaatctctccgatgcccagtcgcacccc
gccttcacctacctgccggagacgggcgaagagatctatcactctttccttggcgttccg
atcctgcgcacgggacgcgcgctcggcgtcctcgtcgtgcagaacaaggcgcagcgcaac
tatcgcgaggacgaggtcgaggcgctggaaacgaccgctatggtgctcgccgagatggtc
gcgaccggcgagctcaagaagatcaccaaacccgggctcgagctcgatctgtcccgcccg
gtgacgatcgagggcaacagctacggcgaaggcatcgggctcggttacgtcgtcctgcat
gagccgcgcatcgtcgtcaccaatctgctcaacgaggacacggagcacgaactgcagcgg
cttgcggaggcgctcggctcgctgcgcatctccatcgacgacatgctgtcgcgccgcgac
gtttcgatggaaggcgaacaccgcgcggtgctcgagacctaccgcatgttcgcccatgac
cgcggctgggtgagaaagctcgaggaggcgatccgcaacggcctgacggcggaagcggcg
gtggagcgggtgcagagcgagaccaaggcgcggatgatccggctgaccgatccgtatctt
cgcgagcggatgcacgatttcgacgatcttgcgaaccggctgttgcgccagctttcgggt
tatggcgccaagctttcggctgccgatttcccgaatgacgcgatcgtcgtcgcgcgcgcc
atgggtgccgcggagttgctcgactatccgcgcgagaacgtgcgcggcctcgtgctggag
gagggggcggtcaccagccacgtggtcatcgtcgcccgcgccatgggcatcccggtggtc
ggccaggcggcgggggcagtggcgctcgccgaaaaccgcgatgcgatcatcgtcgacggc
gacgatgcgaaggtgcatctgcggccgatggccgatctgcagcgcgcttacgaggagaaa
gtgcgcttccgtgcgcgcaggcaggcgcagttccgcgctctccgggatgtcgagccgctg
acgaaggacggcaagcgcattacgttgcagatgaatgccgggctgctggtcgacttgccc
catctgaacgaggcgggtgccgaaggtatcggtctcttccggaccgaactgcagttcatg
atcgcttcaaccatgcccaaggccgaggagcaggaagccttctatcgcaacgtcatgaag
cagacggcggggaagccggtcaccttccggacgctggatatcggcggcgacaaggtcgta
ccctatttccgtgccgcggaagaggagaaccccgccctcggctggcgcgccatcaggctg
tcgctcgatcggccgggtctgctgcgtacccagttccgggcaatgctgagggcgacggcc
ggcgccgaactcaagatgatgctgccgatggtgacggaagtcgcggagctgaagagcgcg
cgagaactcctgcagaaggagatcgagcgccaatcgaagctcggcgaacaattgccgcgc
aagctgcagttcggggcgatgctggaagtgccggcgctgctttggcagctcgacgaactg
atggccgaagtcgatttcgtttcggtcggctcgaacgatctcttccagttcgccatggcg
gtcgaccgcggcaatgcccgtgtttccgaacgattcgacattctcggccggccgttcctg
cggattctccgggagatcgtgcgggccggcgagcgcaacaatacgccggtgacgctttgc
ggcgagatggcaagcaaaccgctttcggccatggcgttgctcgggctcggcttccggtcg
gtttcgatgtcgccgacggctgtcggaccggtcaaggcaatgctcctggcgctcgatgcc
ggcaggctcaacgaactcctcgaggcagcgctcgacgacgtcaaatccgacacgtcgatc
cgccagctcctggtcgatttcgctgcggcgaacggcataccggtttag

DBGET integrated database retrieval system