KEGG   Sinorhizobium meliloti SM11: SM11_chr3194Help
Entry
SM11_chr3194      CDS       T01885                                 

Gene name
glpD
Definition
(GenBank) Glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
smx  Sinorhizobium meliloti SM11
Pathway
smx00564  Glycerophospholipid metabolism
smx01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:smx00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    SM11_chr3194 (glpD)
Enzymes [BR:smx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     SM11_chr3194 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored FAD_binding_2 Pyr_redox_2 NAD_binding_8 FAD_binding_3 K_oxygenase GIDA 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AEH80431
UniProt: F7XAE3
LinkDB All DBs
Position
3204692..3206203
Genome map
AA seq 503 aa AA seqDB search
MSEQTIFDVFVIGGGINGCGIARDAAGRGYSVALAEMSDFASGTSSGSTKLIHGGLRYLE
HYEFRLVREALMEREVLWAMAPHVIWPMRFVLPFHKGGPRPAWLIRLGLFLYDHIGGRKL
LPATKTLDMTRDPAGAPLKGLFTKAFEYSDGWVDDARLVVLNARDAADRGARIMARTRVV
SARREGGRWAIEIESTETGARATMRARMLVNAAGPWVDRVLSEAVGNNDVRNVRLVQGSH
IVVKKKFDDPRAYFFQNPDGRIMFAIPYQDEFTLIGTTDRDFTGNPADVRISDAEIDYLC
RAASEYFSDPVGREDIVWTYSAVRPLFDDGASKAQEATRDYVLRVENGDAPLLNVFGGKL
TTYRRLAESALEKIGETIGEKGRKWTAVSHLPGGDFPAAGYDDEVAKLRTRYPFLTASHA
RRLVRLYGTRAAQLLGNAASEADLGKHFGADLYAAEVDWLIVQEWALRAEDVLWRRTKLG
LKFSRAQTAELEEYMRGAVNAAA
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
gtgtcagagcagacgatcttcgacgtcttcgtcataggcggcggcatcaacggatgcggc
atcgcgcgtgatgcggctggccgcggatattccgtcgcgctggcggagatgagcgatttc
gcctccggaacatcctccggctcgaccaagctcatccatggcggcttgcgctatctcgaa
cattatgaattccgcctcgtgcgcgaagccctgatggagcgcgaagtcctctgggcgatg
gcgccgcacgtgatctggccgatgcgcttcgtgctgcccttccacaagggtggtccgcgg
ccggcatggctgatccgcctcggcctcttcctttacgatcatataggcggccgtaagctt
ctgccggcgacgaagacgctcgacatgacgcgcgatcccgcgggcgcaccgctgaagggc
ctcttcaccaaagcattcgaatattcggacggctgggtcgacgatgctcgcctcgtggtg
ctgaacgcgcgcgacgccgccgaccgcggcgcgaggatcatggcacgcacccgcgtcgtc
tcggcgcgccgcgagggcggccgttgggcaatcgaaatcgagagcacggagacgggcgcg
cgcgcgacgatgcgcgcccgcatgctcgtcaatgccgcgggcccctgggtggaccgggtt
ctctccgaagcggtcggcaacaacgacgtccgcaatgtccgcctggtccagggcagccat
atcgtcgtgaagaagaagttcgacgatccgcgcgcctatttcttccagaacccggacggg
cggatcatgttcgccattccttaccaggacgagttcacgctgatcggaaccaccgatcgc
gatttcaccggcaatccggctgacgtgcgcatcagcgatgcggagatagattatctctgc
agggcggcgagcgaatatttcagcgacccggtcggcagagaggatatcgtgtggacctat
tccgccgtgcgcccccttttcgatgacggtgcgagcaaggcgcaggaggcgacccgcgac
tatgtgctgcgcgtcgagaacggcgatgcaccgctgctcaacgtcttcggcggcaagctc
accacctacaggcggcttgcggaatcggcgctcgagaagatcggcgagaccatcggggaa
aagggcaggaaatggacggccgtatcgcatctgccgggcggcgattttccggccgccggc
tatgacgacgaggtcgcgaagctcaggacgcgctatcctttcctgaccgcttcccacgcc
cgccggctggtacggctctacggcacgcgggcggcgcagcttctcggcaatgccgcgagc
gaggccgacctcggaaagcacttcggcgcggatctctatgctgcggaagtggattggctc
atcgtgcaggaatgggcattgcgcgcggaggacgtgctttggcgccgcacgaaactggga
ctgaagttttcgcgggcgcaaaccgcggaactggaggaatatatgcggggcgcggtcaac
gcggccgcctga

DBGET integrated database retrieval system