KEGG   Sinorhizobium meliloti SM11: SM11_pC1355Help
Entry
SM11_pC1355       CDS       T01885                                 

Gene name
fabI
Definition
(GenBank) enoyl-(acyl carrier protein) reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
smx  Sinorhizobium meliloti SM11
Pathway
smx00061  Fatty acid biosynthesis
smx00780  Biotin metabolism
smx01100  Metabolic pathways
smx01130  Biosynthesis of antibiotics
smx01212  Fatty acid metabolism
Module
smx_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:smx00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    SM11_pC1355 (fabI)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    SM11_pC1355 (fabI)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    SM11_pC1355 (fabI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:smx01004]
    SM11_pC1355 (fabI)
Enzymes [BR:smx01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     SM11_pC1355 (fabI)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     SM11_pC1355 (fabI)
Lipid biosynthesis proteins [BR:smx01004]
 Fatty acid synthase
  Component type
   SM11_pC1355 (fabI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase
Motif
Other DBs
NCBI-ProteinID: AEH82428
UniProt: F7XB29
LinkDB All DBs
Position
pSmeSM11c:complement(1248342..1249127)
Genome map
AA seq 261 aa AA seqDB search
MSIPTVKAKLLEGRKGLIVGIANDRSIAWGCARAFRALGAELAVTYLNDKAKPHVEPLAR
ELDAPIFLPLDMAVPGQIEAVFERIGETWGELDFLVHSIAFSPRDTLGGRVTDAPREGFL
TTMEISCWSFIRMAQLAEPLMKNGGTLFTMTYYGSQVVVENYNIMGVAKAALESAVRYMA
AELGSKGIRVHAISPGALATRAASGIPEFDALLEKTKLKAPANELVDIDDVGMATAFLAH
DAARLITGQVLYVDGGYHIVD
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgtccattccaaccgtcaaggccaagcttctcgaaggtcgtaagggcctgatcgtcggc
attgccaacgatcgctctattgcctggggttgtgcccgcgcgtttcgtgccttgggcgcg
gaactcgcggtgacctatctcaacgacaaggcaaagccacatgtcgagccgctggcacgc
gagctcgacgccccgatcttcctgccgctcgacatggcggtgcctggacagatcgaggcg
gtcttcgagcgcatcggcgaaacctggggagagctcgacttcctcgtccactcgatcgcc
ttctccccgagggacaccctcggcgggcgtgtgaccgatgcgccgcgcgaggggtttctg
actacgatggagatttcctgctggtccttcatccgtatggcgcaactcgcggagccgctg
atgaagaacggtgggacgcttttcacaatgacctattacgggtcacaggtggtggtggag
aactacaacatcatgggggtcgccaaggcagcgctcgaaagcgccgtgcgctacatggcc
gccgagcttggctccaagggcattcgcgtccacgccatatcgccgggggcgcttgccacc
cgagccgcttccggtatcccggaattcgacgcgctgcttgaaaagacgaagctgaaggca
ccggccaacgagctcgtcgacattgatgacgtcggcatggcgaccgcgtttctcgcccac
gacgcggcgcgactcataaccggccaggtgctttacgtcgacggcggctaccacatcgtc
gactag

DBGET integrated database retrieval system