KEGG   Sinorhizobium meliloti SM11: SM11_pD0743Help
Entry
SM11_pD0743       CDS       T01885                                 

Gene name
gabT
Definition
(GenBank) putative 4-aminobutyrate aminotransferase protein
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
smx  Sinorhizobium meliloti SM11
Pathway
smx00250  Alanine, aspartate and glutamate metabolism
smx00410  beta-Alanine metabolism
smx00640  Propanoate metabolism
smx00650  Butanoate metabolism
smx01100  Metabolic pathways
smx01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:smx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SM11_pD0743 (gabT)
   00650 Butanoate metabolism
    SM11_pD0743 (gabT)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SM11_pD0743 (gabT)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SM11_pD0743 (gabT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:smx01007]
    SM11_pD0743 (gabT)
Enzymes [BR:smx01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     SM11_pD0743 (gabT)
Amino acid related enzymes [BR:smx01007]
 Aminotransferase (transaminase)
  Class III
   SM11_pD0743 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AEH83575
UniProt: F7XG99
LinkDB All DBs
Position
pSmeSM11d:786587..787855
Genome map
AA seq 422 aa AA seqDB search
MTSLTDRKNAAISRGVGMTTQVYADRAENAEIWDKEGNRYIDFAAGIAVVNTGHRHPKVI
AAVKAQLDRFTHTCHQVVPYENYVHLAERLNAIVPGDFPKKTIFVTTGAEAVENAVKIAR
AATGRQAVVAFGGGFHGRTFMGMALTGKVVPYKVGFGAMPADVFHAPFPIELHGVTVEQS
LSALKKLFAADVDPARVAAIIIEPVQGEGGFYPVPTAFMKALREVCDQHGILLIADEVQT
GFARTGKLFAMEHHGVAPDLTTMAKSLAGGFPLAAVTGRAEIMDAPGPGGLGGTYGGNPL
GIAAAHAVLDVIAEENLCGRANQLGNRLKQRLAAIREKAPEIVDIRGPGFMNAVEFNDVR
TNLPSAEFANKVRLLALEKGLILLTCGVHGNVIRFLAPITIQDEVFAEALDTIEASILEA
RG
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgacgagcctcacagatcgcaagaatgcagccatctcccgcggtgtcggaatgaccacg
caggtctatgccgatcgcgcggaaaacgccgagatctgggacaaggaaggcaaccgctac
atcgactttgccgccggcatcgccgtggtcaatacaggccaccgccacccgaaggtgatc
gccgccgtcaaggcgcagctcgaccgcttcacccatacatgccaccaggtggtgccctac
gagaactacgtgcatctggcggagcgcctgaacgcgatcgtgcccggcgacttcccgaag
aagaccatcttcgtcacgaccggcgcggaagccgtcgagaacgcagtgaagatcgcgcgg
gccgcgacgggccgccaggcggtcgtcgccttcggcggcggtttccatggccgcaccttc
atgggcatggcgctgacgggcaaggtcgttccgtacaaggtcggtttcggcgcgatgccg
gcagatgtcttccacgcccccttcccgatcgagcttcacggcgtgactgtcgagcagtcg
ctttcggcgctgaagaagctgttcgcggccgatgtcgatccggcccgcgtcgcagcgatc
atcatcgagccggttcagggagaaggcggcttctacccggtcccgaccgccttcatgaag
gcgcttcgcgaggtctgcgaccagcatggcatcctgctgatcgccgacgaggtgcagacc
ggatttgcccgcaccggcaagctcttcgccatggaacatcacggtgtcgcgccggacctg
acgacgatggcgaagagcctcgccggcggctttccgcttgccgccgtcaccggccgcgcc
gaaatcatggatgcgcccgggccgggcggcctcggcggcacctatggcggtaatccgctc
ggcatcgccgccgcgcatgccgtcctcgacgtgattgccgaggagaacctgtgcgggcgg
gcgaaccagctcggcaaccggctgaaacagcgccttgcggcgatccgcgagaaagcaccg
gaaatcgtcgacatccgcggacccggcttcatgaacgccgtcgaattcaacgacgtgagg
acgaacctgccgagcgccgaattcgcaaacaaggtccgcctccttgccctcgaaaagggg
ctcatcctgctgacctgcggcgtccatggcaacgtcatccgtttcctggcgccgatcacg
atccaggacgaggtcttcgcagaagccctcgacactatcgaggcatcgatcctcgaagca
cgcggttga

DBGET integrated database retrieval system