KEGG   Sinorhizobium meliloti SM11: SM11_pD1412Help
Entry
SM11_pD1412       CDS       T01885                                 

Gene name
cbbL
Definition
(GenBank) putative ribulose-1,5-bisphosphate carboxylase large subunit protein
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
smx  Sinorhizobium meliloti SM11
Pathway
smx00630  Glyoxylate and dicarboxylate metabolism
smx00710  Carbon fixation in photosynthetic organisms
smx01100  Metabolic pathways
smx01120  Microbial metabolism in diverse environments
smx01200  Carbon metabolism
Module
smx_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:smx00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SM11_pD1412 (cbbL)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    SM11_pD1412 (cbbL)
Enzymes [BR:smx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     SM11_pD1412 (cbbL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: AEH84244
UniProt: F7XIL1
LinkDB All DBs
Position
pSmeSM11d:1499060..1500520
Genome map
AA seq 486 aa AA seqDB search
MNADAKTEIKGRERYKAGVLKYAQMGYWNGDYEPKDTDLIALFRITPQDGVDPIEAAAAV
AGESSTATWTVVWTDRLTACDQYRAKAYRVDPVPGTPGQYFCYVAYDLILFEEGSIANLT
ASIIGNVFSFKPLKAARLEDMRLPVAYVKTFRGPPTGIVVERERLDKFGKPLLGATTKPK
LGLSGKNYGRVVYEGLKGGLDFMKDDENINSQPFMHWRDRYLYCMEAVNHASAVTGEVKG
HYLNITAGTMEEMYRRAEFAKELGSVIVMVDLIVGWTAIQSISEWCRQNDMILHMHRAGH
GTYTRQKNHGISFRVIAKWLRLAGVDHLHAGTAVGKLEGDPPTVQGYYNVCREMKNEVDL
PRGLFFEQDWADLKKVMPVASGGIHAGQMHQLLDLFGDDVVLQFGGGTIGHPMGIQAGAT
ANRVALEAMVLARNEGRDIAHEGPEILRAAAKWCKPLEAALDIWGNISFNYTPTDTSDFV
PSVTAA
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccgacgcaaagacagagatcaagggccgcgaacgttacaaggcaggcgtgctg
aaatacgcccagatgggctactggaacggagactacgagccgaaggacaccgacctgatc
gcgctcttccggatcacgccgcaggacggcgtcgatccgatcgaagcggccgccgccgtt
gccggcgaaagctcgacggccacatggacggtcgtctggaccgatcgcctgacggcctgc
gatcaataccgcgccaaggcctaccgggtggatccggtgccgggaacgccggggcagtac
ttctgctatgtcgcctacgacctcatcctcttcgaggaagggtcgatcgcgaacctgacg
gcatcgatcatcggcaacgtcttctcgttcaagccgctgaaggcggcaaggctcgaggat
atgcgcctgcccgtcgcctacgtgaagaccttcaggggtccgccgaccggcatcgtcgtc
gagcgcgaacggctcgacaagttcggcaagccgctgctgggtgccacgaccaagccgaag
ctcggcttgtctggcaagaactatggccgcgtcgtctatgaggggctgaagggcggtctc
gacttcatgaaggacgacgagaacatcaattcgcagcccttcatgcattggcgcgaccgc
tacctctactgcatggaggccgtcaatcacgcttccgccgtcaccggcgaggtgaagggg
cactacctcaacatcactgccggcacgatggaggaaatgtaccggcgcgccgaattcgcc
aaggaactcggctcggtcatcgtcatggtcgatctcatcgtcggttggactgctatccag
tcaatatcggaatggtgccggcagaacgacatgatcctgcacatgcaccgggccggtcac
ggcacctatacgcggcagaagaaccacggcatctccttccgcgtgatcgccaaatggctg
cggctcgccggcgtcgaccacctgcatgcgggcacggccgtaggcaagctcgagggcgac
ccgccgacggtgcagggctactacaatgtctgccgcgaaatgaagaacgaggtcgacctt
ccgcgcggtctgttcttcgagcaggactgggcggacctcaagaaggtcatgcccgtcgcc
tcgggcggcatccatgccggtcagatgcaccagctgctcgatcttttcggcgacgatgtc
gtactgcagttcggcggcggcacgatcgggcatccgatgggcatccaggcaggggccacc
gccaatcgcgtcgccctggaagccatggtgcttgcccgcaacgagggccgcgacatcgcc
cacgaaggtcccgagatcctgcgggcggcggcgaagtggtgcaaaccgctggaagcggcc
ctcgatatctggggcaatatcagcttcaactacaccccgaccgatacgtcggatttcgtg
ccgagcgttaccgcggcctga

DBGET integrated database retrieval system