KEGG   Sinorhizobium meliloti SM11: SM11_pD1413Help
Entry
SM11_pD1413       CDS       T01885                                 

Gene name
cbbS
Definition
(GenBank) putative ribulose-1,5-bisphosphate carboxylase small subunit protein
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
smx  Sinorhizobium meliloti SM11
Pathway
smx00630  Glyoxylate and dicarboxylate metabolism
smx00710  Carbon fixation in photosynthetic organisms
smx01100  Metabolic pathways
smx01120  Microbial metabolism in diverse environments
smx01200  Carbon metabolism
Module
smx_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:smx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SM11_pD1413 (cbbS)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    SM11_pD1413 (cbbS)
Enzymes [BR:smx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     SM11_pD1413 (cbbS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: AEH84245
UniProt: F7XIL2
LinkDB All DBs
Position
pSmeSM11d:1500562..1500951
Genome map
AA seq 129 aa AA seqDB search
MRITQGCFSFLPDLTDEQITAQVEYCLGKGWAIGVEYTDDPHPRNTYWEMWGNPMFDLKD
AKGVMMEVEDCRKAHPQDYIRLNAFDSSRGLETVTMSFIVNRPENEPSLRMTRTESNGRS
QHYMWETQR
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatcacccagggatgcttctcgttcctgcccgacctgaccgacgagcagatcacg
gcgcaggtggaatattgccttggaaagggttgggctatcggcgtcgagtataccgacgac
cctcatcctagaaacacctattgggaaatgtggggcaacccgatgttcgacctcaaggac
gccaaaggcgtgatgatggaggtggaggattgccgcaaggcccatccgcaggactatatc
cgcctcaacgccttcgattccagccgcggcctggagacggtgacgatgtcgttcatagtc
aaccgtcccgaaaacgagccgagcctcaggatgacccggacggagagcaacggccgcagc
cagcattatatgtgggaaacgcagcgatag

DBGET integrated database retrieval system