KEGG   Sphingomonas melonis: BJP26_02565Help
Entry
BJP26_02565       CDS       T04509                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
smy  Sphingomonas melonis
Pathway
smy00620  Pyruvate metabolism
smy00680  Methane metabolism
smy01100  Metabolic pathways
smy01120  Microbial metabolism in diverse environments
smy01200  Carbon metabolism
Module
smy_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:smy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BJP26_02565
  09102 Energy metabolism
   00680 Methane metabolism
    BJP26_02565
Enzymes [BR:smy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BJP26_02565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-ProteinID: AOW22588
UniProt: A0A175Y4K0
LinkDB All DBs
Position
512283..514967
Genome map
AA seq 894 aa AA seqDB search
MANIDPASLPPIANNPDVRFLGAKLGDVIRAYGGEALFEATEAIRRASVERHRGTGDGDA
VHRHLQDLGLDETLDFVRGFMLFSMLANLAEDRQGIAAEQGADVAAALATLQAEGIDRAE
VQRLLAHALIVPVLTAHPTEVRRKSMIDHKNRIAELMALKDAGRSETPDGDLVDDAITRQ
IALLWQTRVLRRERLYVTDEVETALSYMRDVFLPALPALYQRWDRAFGERVPSFVKPGSW
IGGDRDGNPFVTADSLRTALSRAAEAVLGFYLDAVHALGAELSISTEHAAVDDAVLALAE
ASGDTAASRSDEPYRRALSGIYARLAATHEALTGKPAARPGRLTGEPYPDPQAFRADLAA
IAHALASAGALKTGGALGRLIRAVETFGFHLATLDLRQNSAVHERVVAELLKTAGVEDDY
LALDEPARVALLRRELAHARPLASRFTTYSDETQSELQIVLAAAEAHATYGPACITNYIV
SMAQSVSDLLEINLLLKEVGLYRGGDEPSAAIMAVPLFETVGDLEAAPGIMTDWFALPEI
AHIAAKRGHQEVMIGYSDSNKDGGYLTSTWQLSKASTALKPVFEAAGVGMQLFHGRGGAV
GRGGGSAFAAIRAQPPGTVQGRIRITEQGEVIAAKYGTRDSAMTNLEAIASATLLASLEP
ERLSNAQNADFTGAMDALSDTAFHAYRDLVYGTDGFRTFFRQMTPIGEIAGLKIGSRPAS
RKKSDAIEDLRAIPWVFSWAQARTMLPGWYGVGQAIAAFEDKALLRDMAQGWPLFAATLA
NMEMVLAKSDIAIAGHYAELVEDKGLRDGIFTRIRDAWHLTHDGLLDVTGQTRLLDKHPA
LDASIRLRLPYIEPLNFLQIELMKRHRAGEDDPRIGEGILLSINAIATALRNSG
NT seq 2685 nt NT seq  +upstreamnt  +downstreamnt
atggccaatatcgaccccgcttcgcttccgccgatcgccaacaaccccgacgtgcgcttc
ctgggcgcgaagctcggcgacgtcattcgcgcctatggcggcgaggcgttgttcgaagcg
accgaggcgatccggcgggcgtcggtggagcgccatcgcggcaccggtgacggcgatgcg
gtgcaccgccacctgcaggacctgggcctcgacgaaacgctcgatttcgtccgcggattc
atgctcttctcgatgctcgccaacctggccgaggatcgccagggcatcgccgccgaacag
ggggcggatgtcgccgcggcgctcgcgacgttgcaggcggaggggatcgaccgcgccgag
gtgcagcgcctgctcgcccatgcgctgatcgtgccggtgctgaccgcccaccccaccgag
gtgcggcgcaagagcatgatcgaccacaagaaccgcatcgccgagctgatggcgctgaag
gatgcgggccgcagcgagacgcctgacggcgatctggtcgacgatgcgatcacccgccag
atcgcgctgctgtggcagacgcgtgtgctgcgccgcgagcggttgtacgtcaccgacgag
gtcgagacggcgctgagctacatgcgcgacgtgttcctgcccgccctccccgcgctctac
cagcgctgggaccgcgcgttcggggagcgcgtgccgagcttcgtcaagccgggaagctgg
atcggcggcgaccgcgacggcaatcccttcgtcaccgccgattcgctgcgcaccgcgctg
tcgcgtgcggcggaggcggtgctcggcttctacctcgacgcggtgcatgcgctgggcgcg
gagctgtcgatctcgaccgaacatgccgcggtggacgacgcggtgctcgcgctggccgag
gcgagtggcgataccgccgccagccgcagcgacgaaccctatcgccgtgcgctgtcgggg
atctatgcgcgccttgccgcgacgcacgaggcactgaccggcaagcccgccgcgcgcccc
ggccggctgaccggcgagccctatcccgacccgcaggcgttccgcgccgaccttgccgcg
atcgcccatgcgctcgcgagcgccggggcgctcaagaccggcggcgcactcggccggctg
atccgcgcagtggagacgttcggcttccacctcgcgacgctcgacctgcgccagaacagc
gcggtccacgaacgcgtcgtcgccgaattgctgaagaccgcaggggtggaggacgattac
ctggccctcgacgagccggcacgcgtcgcgctgctgcggcgcgaactggcgcatgcgcgg
ccgctcgccagccgcttcacgacctattcggacgagacgcagtccgaattgcagatcgtg
ctcgccgccgcggaggcgcatgcgacctacggcccggcgtgcatcaccaactatatcgtc
tcgatggcgcagtcggtgtccgacctgctcgagatcaacctgctgctgaaggaagtgggc
ctgtaccgcggtggcgacgagccgtcggcggcgatcatggcggtgccgctgttcgagacg
gtcggcgatctggaggccgcgcccggcatcatgaccgattggttcgcgctgccggagatc
gcgcacatcgcagcaaagcgcggtcatcaggaggtgatgatcggctattcggacagcaac
aaggatggcggctacctgacctccacctggcagctgtccaaggcgtcgaccgcgctcaaa
cccgtgttcgaggcggcgggcgtcggcatgcagctgttccacggccgcggcggcgcggtg
ggacgcggcggcggcagcgccttcgcggcgatccgcgcgcaaccgccgggcacggtgcag
ggccgcatccgcatcaccgaacagggcgaggtgatcgcggcgaaatacgggacgcgcgac
agcgcgatgaccaatctggaggcgatcgcctcggcgaccttgctcgccagcctggagccc
gagcggctgtcgaacgcgcagaatgcggacttcaccggcgcgatggacgcgctgtccgac
accgcgttccacgcctatcgcgacctcgtctacggcacggacggcttccgcaccttcttc
cgccagatgacgccgatcggcgagatcgcgggcctcaagatcggcagccgcccggcgagc
cgcaagaagagcgacgcgatcgaggatctgcgcgccatcccctgggtgttcagctgggcg
caggcgcgcacgatgctgcccggctggtacggcgtggggcaggcgattgcagcgttcgaa
gacaaggcgctgctacgcgacatggcgcaggggtggccgctgttcgccgcgacgctcgcc
aatatggagatggtgctggcgaagtccgacatcgcgatcgccggccattatgccgaactg
gtcgaggacaagggcctgcgcgacggcatcttcacccgcatccgcgacgcctggcatctg
acgcacgacgggctgctcgacgtgacggggcagacgcggttgctggacaagcacccggcg
ctcgatgcctcgatccggctgcggctgccgtatatcgagccgctgaacttcctgcagatc
gaactgatgaagcgccatcgcgcgggcgaggacgatccgcgcatcggcgagggcatcctg
ctgtcgatcaacgcgatcgcgacggcgctgcggaatagtgggtga

DBGET integrated database retrieval system