KEGG   Sphingomonas melonis: BJP26_12230Help
Entry
BJP26_12230       CDS       T04509                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
smy  Sphingomonas melonis
Pathway
smy00473  D-Alanine metabolism
smy00550  Peptidoglycan biosynthesis
smy01100  Metabolic pathways
smy01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:smy00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BJP26_12230
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BJP26_12230
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    BJP26_12230
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:smy01011]
    BJP26_12230
Enzymes [BR:smy01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BJP26_12230
Peptidoglycan biosynthesis and degradation proteins [BR:smy01011]
 Precursor biosynthesis
  Amino acid ligase
   BJP26_12230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATPgrasp_ST ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: AOW24245
UniProt: A0A175Y6X7
LinkDB All DBs
Position
complement(2577403..2578335)
Genome map
AA seq 310 aa AA seqDB search
MHIAVLMGGWSAERPVSLLSGKGCADALEANGHRVTRIDMGRDVAARLAAAQPDLVFNAL
HGSPGEDGSVQGMLDLMGIPYTHSGLATSVIAIDKVLTKQVLVPAGIPMPGGRIVKSADI
HERDPLQRPYVLKPINEGSSVGVAIVTDDGNYGNPIGRDVAGPWAEFDELLAEPYVRGRE
LTTAVLGERALGVTELKPKTGWYDFDAKYTDGLTEHVCPADIPDEIADACKRLALEAHRL
LGCKGASRSDFRWDDERGVDGLFLLEVNTQPGMTPLSLVPEQARHIGMSYEQLVQAIVDE
ALADAKAAAG
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgcacatcgcggttctcatgggcggctggtccgccgaacgccccgtatcgctcctgtcg
ggcaagggttgcgccgatgcgctcgaggcgaacggccaccgcgtcacccggatcgatatg
ggccgcgacgtcgccgcgcgccttgccgcggcgcagcccgatctcgtcttcaacgcgctg
cacggctcgcccggcgaggacggcagcgtgcagggcatgctcgacctgatgggcatcccc
tatacccattcgggcctcgccacgtcggtcatcgcgatcgacaaggtgctgaccaagcag
gtgctcgtccccgccggcatccccatgccaggcggccggatcgtcaagtccgccgacatc
cacgaacgcgatccgctgcagcgcccctatgtcctcaaacccatcaacgaaggttcgtcg
gtcggcgtcgcgatcgtcaccgatgacggcaattacggcaatccgatcggccgcgacgtg
gcgggaccttgggccgagttcgacgaacttctcgccgaaccctatgtccgcggccgcgag
ctgacgaccgcggtgctgggcgaacgcgcgctgggcgtcaccgaattgaagcccaagacc
ggctggtacgatttcgacgccaaatataccgatggcctgaccgaacacgtctgccctgcc
gacatccccgacgagattgcggacgcctgcaagcggctcgcactggaggcgcatcgcctg
ttggggtgcaagggcgccagccgctccgacttccgctgggacgacgagcgcggcgtcgac
ggcctgttcctgctcgaggtcaacacgcagcccggcatgacgcccttgagcctcgtcccc
gaacaggcgcgccacatcggaatgagctacgaacagctcgtccaggcgatcgtggacgag
gcgctcgccgacgcgaaagctgctgcgggatga

DBGET integrated database retrieval system