KEGG   Stenotrophomonas maltophilia D457: SMD_0025Help
Entry
SMD_0025          CDS       T02061                                 

Definition
(GenBank) Alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
smz  Stenotrophomonas maltophilia D457
Pathway
smz00010  Glycolysis / Gluconeogenesis
smz00071  Fatty acid degradation
smz00350  Tyrosine metabolism
smz00625  Chloroalkane and chloroalkene degradation
smz00626  Naphthalene degradation
smz01100  Metabolic pathways
smz01110  Biosynthesis of secondary metabolites
smz01120  Microbial metabolism in diverse environments
smz01130  Biosynthesis of antibiotics
smz01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:smz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SMD_0025
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SMD_0025
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    SMD_0025
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SMD_0025
   00626 Naphthalene degradation
    SMD_0025
Enzymes [BR:smz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SMD_0025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C TrkA_N 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: CCH10628
LinkDB All DBs
Position
complement(29964..30992)
Genome map
AA seq 342 aa AA seqDB search
MNSTMKAAVVREFGKPLVIEEVSVPRPGAGEVLVRIEACGVCHTDLHAAEGDWPVKPNPP
FIPGHEGVGHVVAVGGGVGHVKEGDRVGIPWLYSACGHCEHCLGGWETLCETQRNTGYSV
NGGFAEYALADANYVGLLPKDVGFVEIAPVLCAGVTVYKGLKVTDTKPGDWVAISGIGGL
GHMAVQYARAMGLNVAAVDVDDNKLALARQLGAQITVNARTTDPAAFLRKEIGGAHGALV
TAVSPKAFEQALGMVRRGGTVSLNGLPPGNFPLDIFGMVLNGITVRGSIVGTRLDLQESL
QFAAEGKVAATVSTDRLENINDVFARMHAGTIEGRVVLDFAA
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaattcgaccatgaaggccgctgtcgtgcgtgagttcggcaagccactggtgatcgag
gaagtctcggtaccacgcccgggggcgggcgaggtactggtcaggatcgaggcctgtggc
gtctgccacaccgacctgcacgccgccgagggcgactggccggtgaaaccgaacccgccg
ttcatccccggccacgagggcgtggggcacgtcgtggccgtgggaggcggggtagggcac
gtcaaggaaggcgacagggtcggcatcccctggttgtactcggcgtgtggccattgcgaa
cactgcctgggtggctgggaaacgctgtgcgagacacagcgcaataccggttactcggtc
aacggcggcttcgccgagtacgcactggccgatgccaactatgtcggcctgcttccgaag
gacgtgggcttcgtcgagatcgcaccggtgctgtgcgccggcgtgaccgtctacaagggc
ctgaaggtcaccgacaccaagcccggcgactgggtggcgatttccggcatcggtggcctg
ggccacatggcggtgcagtacgcccgtgcgatgggcctgaacgtggctgcggtggacgtg
gacgacaacaagctggcattggcccggcagctgggtgcgcagatcaccgtgaacgcgcgc
accaccgatccggccgccttcctcaggaaggagatcggcggcgcgcacggcgccctggtc
acggcggtctcaccgaaggcgttcgagcaggcgctgggcatggtccgccgtggcggcacc
gtctcgctcaacggcctgccgcccggcaatttcccgctggatatcttcggcatggtgctc
aacggcatcaccgtgcgcggctcgatcgtcggcacccggctggacctgcaggagtcgctg
cagttcgccgccgaaggcaaggtcgcggccaccgtcagcaccgaccgcctggagaacatc
aacgacgtgttcgcgcgcatgcacgcgggcaccattgagggccgcgtggtactcgacttc
gccgcctga

DBGET integrated database retrieval system