KEGG   Stenotrophomonas maltophilia D457: SMD_0115Help
Entry
SMD_0115          CDS       T02061                                 

Gene name
sodC2
Definition
(GenBank) Superoxide dismutase [Cu-Zn]
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
smz  Stenotrophomonas maltophilia D457
Brite
Enzymes [BR:smz01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     SMD_0115 (sodC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu Glyco_hydro_81 LPAM_1 CHRD
Motif
Other DBs
NCBI-ProteinID: CCH10717
LinkDB All DBs
Position
146381..147007
Genome map
AA seq 208 aa AA seqDB search
MRLIHTSLFAAIAALGLAACNQQPAAPQAETPPAAPAEGATTEPAATPAPAAAPAADASA
TAELAPTQGNETKGSVTFKVVDGKVHVTGQITGLKPGSEHGFHIHEKGDCSAPDGMSAGG
HFNPGKQDHGNVATDPHHGGDMPNIKADDKGVATIDGPVSSNVNIGKGDDFDIIGRGLIV
HADADDYKTQPTGNAGARLACAVIQKAP
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgcgtctgatccacacttcgctgtttgcggccatcgccgcgctgggcctggcggcctgt
aaccagcaaccggccgcgccgcaggcggaaaccccgccggccgccccggccgagggcgcc
accaccgaaccggccgcaacgccagccccggcggctgcaccggctgccgatgcctcggcc
accgccgaactggcaccgacccagggcaacgaaaccaagggcagcgtcaccttcaaggtg
gtcgacggcaaggtccacgtgaccggccagatcaccggcctgaagccgggcagcgagcac
ggcttccacatccacgagaagggcgactgcagcgcgccggacggcatgagcgccggcggc
cacttcaacccgggcaagcaggatcacggcaacgtcgccaccgatccccaccacggcggc
gacatgcccaacatcaaggccgacgacaagggcgtggccaccatcgacggcccggtgtcg
agcaatgtcaacatcggcaagggtgatgacttcgacatcatcggccgcggcctgatcgtc
cacgccgatgcggacgactacaagacccagccgaccggcaacgccggcgcacgcctggcg
tgtgcggtgatccagaaggccccgtaa

DBGET integrated database retrieval system