KEGG   Stenotrophomonas maltophilia D457: SMD_0499Help
Entry
SMD_0499          CDS       T02061                                 

Gene name
gph
Definition
(GenBank) Phosphoglycolate phosphatase
  KO
K01091  phosphoglycolate phosphatase [EC:3.1.3.18]
Organism
smz  Stenotrophomonas maltophilia D457
Pathway
smz00630  Glyoxylate and dicarboxylate metabolism
smz01100  Metabolic pathways
smz01110  Biosynthesis of secondary metabolites
smz01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:smz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SMD_0499 (gph)
Enzymes [BR:smz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.18  phosphoglycolate phosphatase
     SMD_0499 (gph)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase HAD Hydrolase_like Hydrolase_3 Hydrolase_6 S6PP DNA_photolyase Acid_PPase
Motif
Other DBs
NCBI-ProteinID: CCH11086
LinkDB All DBs
Position
566266..566934
Genome map
AA seq 222 aa AA seqDB search
MSYPYPLVVFDLDGTLVDSAADIAEALNRTLEDIGMARVPEATVLGWIGDGVRRLVEQAV
HAAGREVDLAEVMPVFMVHYRECLLRSPRLFDGVAEALMQLRARGVPLAICTNKPEALVP
PLLQHLGIGDAFALVLSGDSLPQRKPSGEPLRHIAAHFGLAVDACLMVGDSLTDYRAAEE
AGMPIALVRYGYPRGLDLATAQAVAVIDDLRELPGLAAGVRV
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
ttgtcgtatccctatccgctggtcgtgttcgacctagatggcacgctggtcgacagcgca
gctgatatcgccgaagcactgaaccgcacgctggaagacatcggcatggcacgcgtgccg
gaagccacggttctgggctggatcggcgacggtgtgcgccgcctggtcgagcaggccgtg
cacgccgcgggtcgtgaggtcgacctggccgaagtgatgccggtgttcatggtgcactac
cgtgagtgcctgctgcgcagcccgcgcctgttcgatggcgtggccgaagcgctgatgcag
ctgcgtgcacgcggtgttccgctggcgatctgcaccaacaagcccgaagcgctggtgccg
ccactgctgcaacacctgggcattggtgatgcgttcgcgctggtactgagcggcgattcg
ctgccgcagcgcaagcccagcggtgagccgctgcggcacatcgctgcgcacttcgggctg
gcggtggatgcctgcctgatggtgggtgattcgttgaccgactaccgcgccgccgaagag
gcaggcatgccgatcgcactggtgcgttacggttatccgcgtggcctggacctggccacc
gcacaggcggtggcggtgattgacgacctgcgtgagttgccggggttggccgcgggcgtt
cgggtgtag

DBGET integrated database retrieval system