KEGG   Stenotrophomonas maltophilia D457: SMD_0719Help
Entry
SMD_0719          CDS       T02061                                 

Gene name
ahpF
Definition
(GenBank) Alkyl hydroperoxide reductase protein F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
smz  Stenotrophomonas maltophilia D457
Brite
KEGG Orthology (KO) [BR:smz00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SMD_0719 (ahpF)
Enzymes [BR:smz01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     SMD_0719 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like DAO FAD_oxidored AlaDh_PNT_C Glutaredoxin Thi4 FAD_binding_3 K_oxygenase NAD_binding_8 Thioredoxin_4 FMO-like
Motif
Other DBs
NCBI-ProteinID: CCH11304
LinkDB All DBs
Position
complement(825477..827069)
Genome map
AA seq 530 aa AA seqDB search
MLDANLQSQLKTYLERVTRPIQITAHADDGAKSQEMLELLQTLDSLSDKISLQVLRDGQG
RVPSFDLGTPGQDIHLTFAGLPMGHEFTSLVLALLQVGGHPSKATAELIEQVQNLEGDYR
FETYFSLSCQNCPDVVQALNLAAVLNPRIQHVAIDGALFQDEVEKREIMSVPTVYLNGEI
FDQGRMTLEQIVAKLDTNAGKRDAEKIAAKDAFDVLVVGGGPAGAAAAIYAARKGIRTGI
AAERFGGQVLDTMAIENFISVKETEGPKLATALEQHVREYEVDIMNLQRASALVPAGEDG
LVQVQLENGAVLKSRSVILSTGARWRQMNVPGEDQYRNKGVAYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVSHVTLLEFDSSLRADEVLQKKLRSLGNVTVLTSAQTTEVLGDG
SRVTGLVYKDRVGGDAHRVELEGIFVQIGLLPNTEWLKDVVALSPRGEIVIDDRGQTNLP
GVFAAGDCTTVPYKQIIIAMGAGSTAALSAFDHLIRSSVSNSSGAVAEAA
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgccaacctgcagtcgcagctgaagacctatctggagcgcgtgacccgcccg
atccagatcaccgcgcacgccgacgacggcgccaagtcgcaggaaatgctggaactgctg
cagaccctggacagcctgtcggacaagatctcgctgcaggtgctgcgcgatggccagggc
cgcgtgccgtccttcgacctgggcaccccgggccaggacatccacctgaccttcgccggc
ctgccgatgggccacgagttcacctcgctggtgctggcgctgctgcaggtcggcgggcac
ccgtccaaggccactgccgagctgatcgagcaggtgcagaacctggaaggcgactaccgg
ttcgagacctacttctcgctgtcctgccagaactgcccggacgtggtgcaggcgctgaac
ctggccgcggtgctcaacccgcgcatccagcacgtggccatcgatggcgccctgttccag
gacgaagtcgagaagcgcgagatcatgtcggtgccgaccgtgtacctcaacggtgaaatc
ttcgaccagggccgcatgaccctcgagcagatcgtggccaagctggacaccaacgccggc
aagcgcgatgccgagaagatcgccgccaaggacgccttcgacgtgctggtggtgggcggc
ggcccggccggcgctgcagcggcgatctacgccgcacgcaagggcatccgtaccggcatc
gccgccgagcgtttcggtggccaggtgctggacaccatggcgatcgagaacttcatttcg
gtgaaggagaccgagggccccaagctggccacggcgctggagcagcacgtgcgcgagtac
gaggtggacatcatgaacctgcagcgcgccagtgcgctggtgccggccggcgaagacggc
ctggtgcaggtgcagctggaaaacggcgcggtactgaagtcgcgttcggtgatcctgtcc
accggcgcgcgctggcggcagatgaacgtgccgggcgaagaccagtaccgcaacaagggc
gtggcgtactgcccgcactgcgatggcccgctgttcaagggcaagcgcgtggcggtgatc
ggcggcggcaactccggcgtggaagcggccatcgacctggccggcatcgtgtcgcatgta
accctgctggagttcgattccagcctgcgcgccgatgaagtgctgcagaagaagctgcgc
agcctgggcaacgtgaccgtgctgaccagcgcgcagaccactgaagtgctgggcgacggc
agccgcgtcaccggcttggtctacaaggaccgcgtcggcggcgatgcccaccgcgtcgag
ctggaaggcatcttcgtgcagatcggcctgctgcccaacaccgagtggctgaaggatgtg
gtggcgctgtcgccgcgcggcgagatcgtcatcgacgaccgcggccagaccaacctgccg
ggcgtgttcgccgctggcgattgcacgacggtgccctacaagcagatcatcattgccatg
ggcgccggctcgaccgccgcactgagtgcgttcgaccacctgatccgctcgtcggtgagc
aacagcagcggtgccgttgctgaagcagcctga

DBGET integrated database retrieval system