KEGG   Stenotrophomonas maltophilia D457: SMD_1820Help
Entry
SMD_1820          CDS       T02061                                 

Gene name
gst2
Definition
(GenBank) Glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
smz  Stenotrophomonas maltophilia D457
Pathway
smz00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:smz00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SMD_1820 (gst2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:smz02000]
    SMD_1820 (gst2)
Enzymes [BR:smz01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     SMD_1820 (gst2)
Transporters [BR:smz02000]
 Other Transporters
  Pores ion channels [TC:1]
   SMD_1820 (gst2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_2 GST_C_3
Motif
Other DBs
NCBI-ProteinID: CCH12365
LinkDB All DBs
Position
2008006..2008695
Genome map
AA seq 229 aa AA seqDB search
MRIVHHLENSRSLRVLWMLEELGLDYELRRYPRDPKTLLAPPELRNVHPLGKSPVLQDGE
LVLAESGAILDYLADRYDTQRQLSPSPMPADGAERIAYRYWLHYAEGSAMPPLLLTLVMG
RIRNAPMPFFARPIARSIADKAERGFIGPQRRLHLDWMERRLAESPWFAGERFSAADIQM
SFPIQAAAARGGGLDDKPALRGFLKRIGERPAYQRAEAHGGHLQALGGN
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatcgtccaccatctggaaaactcccgttcgctgcgcgtgctgtggatgctggag
gagctggggttggactacgaactgcgccgctatccgcgcgatccgaagacgctgctggcg
ccgccggaactgcgcaacgtgcatccgctcggcaagtcgccggtactgcaggatggtgag
ctggtactggccgagtccggcgcgatcctcgactacctcgctgaccgttacgacacgcaa
cgccagctgtcgccgtcaccaatgccggccgacggggccgaacgcatcgcttaccgctac
tggctgcactacgccgaaggctcggcgatgccaccgttgctgctgaccctggtgatgggc
cgcatacgcaacgcgccaatgccgttcttcgcgcgcccgatcgcacgcagcattgccgac
aaggccgagcgcggcttcatcggcccgcagcggcgcctgcacctggactggatggagcgc
cgcctggccgaaagcccgtggtttgccggcgagcgtttcagtgcggccgacatccagatg
agcttcccgatccaggccgctgccgcgcgcggtggtggcctggacgacaaaccggcactg
cgtggcttcctcaagcgtatcggtgaacgcccggcctaccagcgtgccgaggcccacggc
ggccacctgcaggcgctcggcggcaattga

DBGET integrated database retrieval system