KEGG   Stackebrandtia nassauensis: Snas_0051Help
Entry
Snas_0051         CDS       T01194                                 

Definition
(GenBank) Beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
sna  Stackebrandtia nassauensis
Pathway
sna00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:sna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    Snas_0051
Enzymes [BR:sna01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Snas_0051
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_42C Glyco_hydro_35 Glyco_hydro_14 Glyco_hydro_2_C
Motif
Other DBs
NCBI-ProteinID: ADD39773
UniProt: D3Q0A9
LinkDB All DBs
Position
57727..59718
Genome map
AA seq 663 aa AA seqDB search
MARFNERLSRIAFGGDYNPEQWDEEVWAEDMRLMTEAGVSMVSLGIFSWAKVEPRPGEYD
FGWVDRIFELLSANDIAVCLATMTASPPPWLARLHPETLPMLPDGSRLWPGGRQHYCPSS
PEYRRYATRLVAKLAERYGDHPALAMWHIGNEYGCHVPECFCDVSAVAFRGWLRERYGDL
DTLNDAWSTSFWSQAYGDWDEIFPPRSVPAFHNPAQRLDFSRFSSDELLACYLAETEITN
RVTPNVPVTTNFVGAWRRINTMKWARHMDVVSYDSYPDPHDPEAAADSALAYDLMRSLRD
GQPWLLMEQAPSAVNWRERNGAKPRDVMRLWSWQAIAHGADSVLYFQWRASRGGAERFHS
GMVPHAGENTRIHREIRQLGNELKGHSALVGTRQTCDVALVIDWDSGWAVEGTSHPSDDV
RLMDAVAAHHRPLYDANVAVDFVRPGADLSKYKLVVVPNLYLVSEADARNISDYVHGGGT
VLMSFFSGIVDEYDRVHLGGYPAPFRELLGLWIEEFWPLPRGGSTGISFDGDLSALGSDT
ATRWSEVIRTEGAETLATFAGGDLDGEPAATRHRFGDGEAYYLGTRPSPERMRSLLDHLR
QRTAVAPTLADLPDGVQARTRVGEDGTAHHILLNHTARPVTVTVDGAAVELAAHDVAVVT
AKA
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgcttcaacgagcgtctcagccgtatcgccttcggcggcgactacaaccccgag
cagtgggacgaggaggtgtgggccgaggacatgcggctgatgaccgaggccggagtgtcc
atggtgagcctgggcatcttctcgtgggcgaaggtcgagccgcgacccggcgagtacgac
ttcggctgggtggaccgcatcttcgagctgttgtccgccaacgacatcgcggtgtgcctg
gcgaccatgacggcctcgccgccgccgtggctggcccggctgcatcccgagacgctaccg
atgctgcccgacggttcccggctgtggccgggcggacggcagcactactgtccgtcctct
ccggagtaccgccgctacgccacccggctggtggccaagctcgccgaacgctacggcgac
cacccggcgctggcgatgtggcacatcggcaacgagtacggatgccatgtccccgaatgc
ttctgcgacgtctcggcggtcgcgttccgcggttggctgcgcgaacggtacggcgacctc
gacaccctcaacgacgcctggtcgacgagcttctggtcgcaagcgtacggagactgggac
gagatcttcccgccccgctcggtgcccgcgttccacaacccggcgcagcggctggacttc
tcgcgcttcagctcggacgaactgctggcctgctacctcgccgaaaccgagatcaccaac
cgggtcaccccgaacgtcccggtcaccaccaacttcgtgggcgcctggcgccgcatcaac
acgatgaaatgggcccggcacatggacgtcgtcagctacgactcctatccggacccgcac
gaccccgaggccgccgccgactccgcgctggcctacgacctgatgcggtccttgcgcgac
ggccagccctggctgctgatggagcaggcgcccagcgccgtcaactggcgggaacgcaac
ggcgccaagccacgcgacgtcatgcgactgtggagctggcaggcgatcgcgcacggcgcc
gactcggtgctgtacttccagtggcgggcctcgcgcggcggcgccgaacggttccacagt
ggcatggtgccgcacgcgggcgagaacacccgaatccaccgcgagatccggcagctcggc
aacgaactgaagggacactcggcgctggtgggcacccgacagacgtgcgacgtcgcgctg
gtcatcgactgggactccggctgggccgtcgagggaacctcgcaccccagcgacgacgtc
cggctcatggacgccgtggccgcgcaccaccgtccactgtatgacgccaacgtggcggtc
gacttcgtgcggcccggcgccgacctgtcgaagtacaagctggtcgtggtgccgaacctg
tacctggtcagcgaagccgacgcgcggaacatctccgactacgtccacggcggcggcacg
gttttgatgtcgttcttctccggcatcgtcgacgagtacgaccgggttcacctcggcggc
tacccggcgccgttccgggaactgctgggactgtggatcgaggagttctggccgctgccg
cggggcggaagcaccggcatcagcttcgacggcgatctgtccgctttgggcagtgacacc
gcgacgcggtggtcggaggtcatccgcaccgagggggccgagaccctggcgaccttcgcc
ggtggcgacctggacggcgaaccggccgccacccggcatcgcttcggcgacggcgaggcg
tactacctgggcacccgtcccagcccggaacggatgcggtcgctgctggaccacctgcgg
cagcgcaccgccgtcgcaccgacgctggcggacctgcccgacggcgtccaggcccgcacc
cgggtcggcgaggacggcacggcgcaccacatcctgctcaaccacaccgcgcggccggtg
accgtcaccgtggacggtgccgcggtcgagttggccgcgcacgacgtcgcggtggtgacc
gcgaaggcctaa

DBGET integrated database retrieval system