KEGG   Stackebrandtia nassauensis: Snas_0223Help
Entry
Snas_0223         CDS       T01194                                 

Definition
(GenBank) peptidase S8 and S53 subtilisin kexin sedolisin
  KO
K14645  serine protease [EC:3.4.21.-]
Organism
sna  Stackebrandtia nassauensis
Pathway
sna02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:sna00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Snas_0223
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sna01002]
    Snas_0223
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:sna03110]
    Snas_0223
Enzymes [BR:sna01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     Snas_0223
Peptidases and inhibitors [BR:sna01002]
 Serine peptidases
  Family S8: subtilisin family
   Snas_0223
Chaperones and folding catalysts [BR:sna03110]
 Intramolecular chaperones
  Subtilisin family
   Snas_0223
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S8 PKD Inhibitor_I9 DUF5011 Big_3 I-EGF_1
Motif
Other DBs
NCBI-ProteinID: ADD39942
UniProt: D3Q1U4
LinkDB All DBs
Position
238770..240560
Genome map
AA seq 596 aa AA seqDB search
MKLPPARRLLVAVGTVTAITATTVLAGAPAAHAAEAEIVNSDASGVIEDRYIAVLRDSAV
KATQKSVDAKAETLADKYHGEIDRTYHATIRGFATTMDESDAKRLAADPVVDYVETVREV
KLAEDQTNPPSWGLDRVDQNNLPLDKKFSYPTQAGDGVTVYVLDTGVRLSHQTFGGRAKS
GYDFIDNDANASDCHGHGTHVAGTTAGSQYGLAKKADVVSVRVLDCQGFGDNALIADGID
WVTEHAVKPAVANMSLGDTQPSPVMEDAVQRSIDAGIQYSLAAGNNSGDACSFSPARLPA
AVTVGSTAESDGRSSFSNYGRCLDLFAPGSNIVSSANSGDSGQATMSGTSMAAPHVAGAI
ALYLGQNPNATPQQVRDAIVTNGTAGKVTNPGSGSPNVLLYSGFINEPPAEHDFSIAADP
GSATVEPGQSAKTTVSTKVTKGQAQQLKLSATGLPSGAQASFDPAAIASGESSQLSIATS
SGTPKGSYPVTITAEGTEATRTASFTLQVGADGGNKQPIADFTSNCFAGIGYCFFDGNGS
SDPDGSVASYKWNFGDGTTGTGAAPFHRYSPGTYKVTLTVTDNKGATGSVTKTVTV
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgaagctcccacccgcccggcgcctcctggtggccgtcggcacggtcacggccatcacg
gccaccaccgtgctcgccggcgccccggccgcgcacgcggccgaagccgagatcgtcaac
agcgacgcatccggcgtcatcgaggaccgctacatcgcggtcctgcgcgacagcgcggtc
aaagccacccagaagtcggtcgacgccaaggccgaaacgctcgccgacaagtaccacggt
gagatcgaccgcacctaccacgccaccatccgcggtttcgccaccaccatggacgaatcc
gacgcgaagcggctggcggccgacccggtcgtcgactacgtcgagaccgtccgcgaggtc
aaactggccgaggaccagaccaacccgcccagctggggtctggaccgcgtcgaccagaac
aacctgccgctggacaagaagttcagctacccgacccaggccggagacggcgtcacggtc
tacgtcctcgacaccggggttcgactgagccaccagactttcggcggccgcgcgaagtcg
ggctacgacttcatcgacaacgacgccaacgcctccgactgccacggacacggcacccac
gtcgccggaacgaccgccggaagccagtatggtctcgccaagaaggccgacgtcgtgtcg
gtacgggtcctcgactgccagggcttcggcgacaacgccctcatcgccgacggcatcgac
tgggtcaccgagcacgccgtcaaaccggcggtcgccaacatgagcctcggtgacacccag
cccagcccggtcatggaggacgccgtgcagcgttccatcgacgccgggatccagtactcg
ctggcggccgggaacaacagcggcgacgcctgcagtttctccccggcgcggctgcccgcg
gccgtgaccgtcggatcaaccgctgaatccgacggccgcagctcgttcagcaactacggc
cgctgcctcgacctgttcgcgcccggctcgaacatcgtgtcctcggccaactccggcgac
tccggccaggccaccatgagcggcacctcgatggccgcgccacacgtggccggggcgatc
gcgctctacctgggacagaacccgaacgcgaccccgcaacaggttcgcgacgccatcgtc
accaacggcaccgccggaaaggtcaccaacccgggctcgggttcgccgaatgtcctgctg
tacagcggtttcatcaacgaaccacccgccgagcacgacttcagcatcgccgccgacccc
ggctcggcgaccgtcgaacccggacagtcggccaagaccacggtgtccacgaaggtcacc
aagggacaggcccagcagctgaaactctccgccaccggactgccgtccggcgcccaggcc
agcttcgacccggccgccatcgcctccggcgagagctcacaactgtcgatcgcgacctcg
tccggcacccccaagggctcgtacccggtgaccatcaccgccgaaggcaccgaagccacc
cgcaccgcgagcttcacgctccaggtaggagccgacggcggcaacaaacaaccgatcgcc
gacttcacctcgaactgcttcgccggtatcggctactgcttcttcgacggcaacggctcc
tccgacccggacggctccgtcgccagctacaagtggaacttcggtgacggcaccaccggc
accggagccgcacccttccaccgctactcacccggaacctacaaggtgaccctcacggtc
accgacaacaagggagcgaccggatcggtcaccaagaccgtcacagtctga

DBGET integrated database retrieval system