KEGG   Stackebrandtia nassauensis: Snas_0658Help
Entry
Snas_0658         CDS       T01194                                 

Definition
(GenBank) methylmalonate-semialdehyde dehydrogenase
  KO
K00140  malonate-semialdehyde dehydrogenase (acetylating) / methylmalonate-semialdehyde dehydrogenase [EC:1.2.1.18 1.2.1.27]
Organism
sna  Stackebrandtia nassauensis
Pathway
sna00280  Valine, leucine and isoleucine degradation
sna00410  beta-Alanine metabolism
sna00562  Inositol phosphate metabolism
sna00640  Propanoate metabolism
sna01100  Metabolic pathways
sna01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Snas_0658
   00562 Inositol phosphate metabolism
    Snas_0658
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Snas_0658
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Snas_0658
Enzymes [BR:sna01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.18  malonate-semialdehyde dehydrogenase (acetylating)
     Snas_0658
    1.2.1.27  methylmalonate-semialdehyde dehydrogenase (CoA-acylating)
     Snas_0658
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ADD40371
UniProt: D3Q6X2
LinkDB All DBs
Position
complement(690287..691777)
Genome map
AA seq 496 aa AA seqDB search
MTTIQHWIDGTATAADSTRTAPVWNPATGRQQAEVLLAEADAVDRAVAAARRAFETWGEV
SLSARSKVMFALRQLLERHEDELARIICAEHGKAIDDARGEIVRGREVVEFACGIAEVLK
GSFSNEVSSGVDLHSFRQPLGVCAGITPFNFPIMVPMWMHPVAIATGNTFVLKPSERDPS
ASNFVAQLYADAGLPDGVFNVVHGDKTAVDAILDHPDVAAVSFVGSTPIARYVHERAQSA
GKRVQALGGAKNHAVVMPDADLGFAADQLTAAAFGSAGQRCMAVSVAVTVGDAADALVPV
LRDKASGLNVGPGSEPGVDMGPVVTSQARDRIAGYVASGVKQGAEPVLDGREFRRDGDGF
FIGPTVLDRVTSDMDVYRDEVFGPVLSVVRAETVEAAIDLINANPYGNGTAIFTSDGAVA
RRFEREVRVGMVGVNVPIPVPMSYYSFGGWKDSLFGETHIHGPEGVRFYTRLKVVTSRWP
SQPRQVASRLHFPTAS
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccatccagcactggatcgacgggaccgccacggcggcggactcgacccgcacc
gcgccggtgtggaatccggcgaccgggcggcagcaggccgaggtgctgctcgccgaggcc
gacgccgtcgaccgggcggtggcggcggcccgacgggccttcgaaacctggggcgaggtc
tcgctgtcggcgcgctcgaaggtcatgttcgcgttgcggcagctgctggaacgccacgag
gacgagctggcccggatcatctgcgccgaacacggcaaggccatcgacgacgcgcgcggt
gagatcgtccggggccgggaggtcgtcgagttcgcctgcggcatagccgaagtgctgaag
ggttcgttctccaacgaggtgtccagcggcgtcgacctgcactcgttccggcagccactg
ggggtgtgcgcgggcatcaccccgttcaacttcccgatcatggttccgatgtggatgcac
ccggtcgccatcgccaccggcaacaccttcgtcctcaaacccagcgagcgcgacccgtcg
gcgtccaacttcgtcgcccagctgtacgccgacgccgggctgcccgacggcgtgttcaat
gtggtgcacggcgacaagaccgccgtggacgcgattctggaccaccccgacgtcgcggcg
gtgtcgttcgtcggttccaccccgatcgcccgctacgtgcacgaacgggcccagtcggcc
gggaaacgggtgcaggcgctgggcggcgccaagaaccacgcggtcgtgatgcccgacgcc
gatctcggcttcgccgccgaccagctgaccgccgcggccttcggttcggccggtcagcgc
tgcatggcggtgtcggtggccgtgaccgtcggcgacgccgccgacgcgctggtgccggtg
ttgcgggacaaggcttccggcctgaacgtcggccccggttccgagccgggtgtcgacatg
ggaccggtggtgacctcgcaggcccgcgaccggatcgccggatacgtcgcctcgggtgtc
aagcagggtgccgagccggtgctggacggccgcgagttccgccgcgacggggacggcttc
ttcatcgggccgacggtcctggaccgggtgacctccgatatggacgtctaccgggacgag
gtgttcgggccggtcctgtcggtggtgcgcgccgagacggtggaggcggcgatcgacctg
atcaacgccaacccgtacggcaacggcaccgcgatcttcacgtcggacggtgccgtggcg
cgccgtttcgaacgcgaggtgcgggtcgggatggtgggtgtcaacgtgccgatcccggtc
ccgatgtcctactactcctttggcggctggaaggactcgctgttcggcgagacccacatc
cacggccccgagggcgtgcggttctacacccggctgaaggtggtgacctcccgctggccg
agccagccgcgccaggtcgcctcccggctgcacttccccaccgcgagttga

DBGET integrated database retrieval system