KEGG   Stackebrandtia nassauensis: Snas_0775Help
Entry
Snas_0775         CDS       T01194                                 

Definition
(GenBank) methylmalonyl-CoA mutase, large subunit
  KO
K01848  methylmalonyl-CoA mutase, N-terminal domain [EC:5.4.99.2]
Organism
sna  Stackebrandtia nassauensis
Pathway
sna00280  Valine, leucine and isoleucine degradation
sna00630  Glyoxylate and dicarboxylate metabolism
sna00640  Propanoate metabolism
sna01100  Metabolic pathways
sna01120  Microbial metabolism in diverse environments
sna01200  Carbon metabolism
Module
sna_M00741  Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA
Brite
KEGG Orthology (KO) [BR:sna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Snas_0775
   00640 Propanoate metabolism
    Snas_0775
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Snas_0775
Enzymes [BR:sna01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.2  methylmalonyl-CoA mutase
     Snas_0775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MM_CoA_mutase
Motif
Other DBs
NCBI-ProteinID: ADD40487
UniProt: D3Q7Y2
LinkDB All DBs
Position
818765..820345
Genome map
AA seq 526 aa AA seqDB search
MSQRHSESGFELRPVYGPDDVAEGLTGRLGQPGQYPYTRGPYPTMYTTRPWTMRQYAGFG
TATESNRRYHQLLEAGTTGLSVAFDLPTQMGYDSDAELAAGEVGKVGVAIDSLADMRTLF
GGIPLDKVSTSMTINAPASLLLLLYQLVAEEQGVAPDALSGTIQNDILKEYIARGTYIFP
PAPSLRLVSDTFAYCRNEIPKWNTISISGYHMAEAGATPVQEVAFTLANGIEYVRAAIDA
GMDVDEFAPRLSFFFVARTTLLEEIAKFRAARRIWARVMRDDFGAKNPKSQMLRFHTQTA
GVQLTAQQPEVNLVRVALQGLGAVLGGTQSLHTNSFDEAIALPTEKAARLALRTQQVLAY
ETDVTATVDPFAGSYLMESMTDEIESAADQLIERVFDFGSSVAAIESGFQKNEIETTAYA
TSQEIDSGERVVVGVNRFALDEEEPYEPLRVDPGIEAAQRDRLEKLRSERDNAEVTAALT
AVREAAEGTDNVLYPAKRALKAMATVGEVCNALRGVWGSYRPPESF
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcagcgtcacagcgagtccggtttcgagctccgtccggtgtacggccccgacgac
gtcgccgagggtctcaccggacgactggggcagccgggtcagtacccgtacacccggggc
ccctacccgacgatgtacaccacccggccctggacgatgcgccagtacgccggcttcggc
accgccaccgagtcgaaccgccgctaccaccagctgctggaggcgggcaccaccggactg
tcggtggccttcgacctgcccacccagatgggctacgactccgacgccgaactggccgcc
ggtgaggtcggcaaggtcggggtggccatcgactcgctggccgacatgcgcaccctgttc
ggcggcatcccgctggacaaggtctccacctcgatgaccatcaacgccccggcctcgctg
ctgttgctgctgtaccaacttgtcgccgaggaacagggcgtggcgcccgacgcgctttcc
ggcacgatccagaacgacatcctcaaggagtacatcgcgcgcgggacctacatcttcccg
cccgctcccagcctgcggctggtctccgacaccttcgcctactgccgcaacgagatcccg
aagtggaacaccatctcgatctccggctaccacatggccgaggccggggccacccccgtg
caggaggtcgcgttcacgctcgccaacggcatcgagtacgtgcgcgccgccatcgacgcc
ggcatggacgtcgacgagttcgcgccccggctgtcgttcttcttcgtcgcccgcaccacg
cttctggaggagatcgcgaagttccgcgccgcccggcgcatctgggcccgcgtcatgcgc
gacgacttcggcgccaagaacccgaaatcgcagatgctgcggttccacacccagaccgcg
ggcgtgcagctgaccgcccagcagcccgaggtcaacctggtccgggtcgcgctccagggc
ctgggggcggtactgggcggcacccagtccttgcacaccaacagtttcgacgaggccatc
gcgctgccgaccgagaaggccgcccggctggcgctgcgcacccagcaggtgctcgcctac
gagaccgacgtgaccgcgaccgtcgacccgttcgccggttcgtacctgatggagtcgatg
accgacgagatcgaatcggccgccgatcagctcatcgagcgggtattcgacttcggttcc
tcggtggcggccatcgaatccggattccagaagaacgagatcgagacgaccgcctacgcc
acttcccaggaaatcgactccggtgaacgcgtcgtcgtcggcgtcaaccgattcgcgctc
gacgaggaggagccgtacgaaccgctgcgcgtcgatcccggaatcgaggcggcgcagcgt
gaccggctggagaaactgcgttccgagcgcgacaacgccgaggtgacggcggcactgacc
gcggtacgtgaagccgccgagggaaccgacaacgttctgtatccggccaaacgcgcattg
aaggcgatggctaccgtgggcgaggtttgcaatgcgttgcgtggggtatggggttcatat
cgcccgcctgagtccttttga

KEGG   Stackebrandtia nassauensis: Snas_1393Help
Entry
Snas_1393         CDS       T01194                                 

Definition
(GenBank) methylmalonyl-CoA mutase, large subunit
  KO
K01848  methylmalonyl-CoA mutase, N-terminal domain [EC:5.4.99.2]
Organism
sna  Stackebrandtia nassauensis
Pathway
sna00280  Valine, leucine and isoleucine degradation
sna00630  Glyoxylate and dicarboxylate metabolism
sna00640  Propanoate metabolism
sna01100  Metabolic pathways
sna01120  Microbial metabolism in diverse environments
sna01200  Carbon metabolism
Module
sna_M00741  Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA
Brite
KEGG Orthology (KO) [BR:sna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Snas_1393
   00640 Propanoate metabolism
    Snas_1393
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Snas_1393
Enzymes [BR:sna01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.2  methylmalonyl-CoA mutase
     Snas_1393
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MM_CoA_mutase
Motif
Other DBs
NCBI-ProteinID: ADD41100
UniProt: D3PV47
LinkDB All DBs
Position
1478162..1479898
Genome map
AA seq 578 aa AA seqDB search
MDANDISAGRKRWQERYDAARKRDADFTTLSGLEVEPAYGPAEGSTDPRLGRIGWPGEFP
FTRGLYPTGYRGRAWTIRQFAGFGNAVQTNERYKMLLKSGGGGLSVAFDMPTLMGRDSDD
PQSLGEVGHCGVAIDSAADMDVLFGGIPLADVTTSMTISGPAVPVFCMYLASAERQGADI
SKLDGTLQTDIFKEYIAQKEWLFPPEPHLRLIGDLMAYTNAEIPRYKPLSVSGYHIREAG
STAAQELAFTIADGFGYVELGLSRGLDVNTFAPGLSFFFDSHIDFFEEIAKFRAARRIWA
RWMRDVYGATSERAQWMRFHTQTAGVSLTAQQPTNNVVRTAVEALAAVLGGTNSLHTNAL
DETLALPTDETAEIALRTQTVLMEETGITNVADPLGGSWYVEALTDRIEAEAEAIFTQIL
ALGGESDGSTAGQTAREAMGTGRHEIGPVTSGILRGIEEGWFTAGIAEAAFTYQQQLERG
EKKIVGVNCHTETVAKELEILRISGDVEREQVAALADRRSNRDKDTVDAALNRMVQVSRT
DDNIIPAMMDAVRVEATLGEICDALRAEWGEYREPARF
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
gtggacgccaacgacatctccgcaggccgcaagcgctggcaggaacgctacgacgccgct
cgcaagcgggacgctgacttcaccacgctgtccgggctggaagtcgagcccgcctatggg
cccgccgagggctcgaccgacccgcggttggggcggatcgggtggcccggcgagtttccg
ttcacccgggggctgtacccgaccgggtatcgggggcgggcgtggacgattcgccagttc
gcggggttcggcaacgctgttcagaccaacgagcggtacaagatgctgctcaagtcgggt
ggtggcgggttgtcggtcgccttcgacatgccgacgctgatgggccgggactccgacgac
ccccagtcgctgggggaggtcgggcactgtggggtggcgatcgactccgccgccgacatg
gacgtcctgttcggcggtattccgctggccgacgtgacgacgtcgatgacgatctcgggt
ccggccgtgccggtgttctgcatgtacctggcctcggccgagcggcagggcgccgacatc
tcgaagctcgacggcacgctgcagaccgacatcttcaaggagtacatcgcgcagaaggag
tggctgttcccgccggaaccccacctgcgcctgatcggcgacctgatggcctacaccaac
gccgagatcccgcgctacaagccgctgtcggtgtccggctaccacatccgtgaggccggt
tcgaccgccgctcaggagctcgcgttcaccatcgccgacgggttcggttacgtcgagctg
ggcctgtcgcgcggtctcgacgtcaacaccttcgcgcccggactgtcgttcttcttcgac
tcgcacatcgacttcttcgaggagatcgccaagttccgcgccgcccgccgcatctgggcg
cgctggatgcgcgacgtctacggcgccaccagtgaacgggcgcagtggatgcgtttccac
acccagaccgcgggtgtgtcgctgacggctcagcagcccaccaacaacgtggtccgcacc
gccgtcgaagcgctcgcggccgtcctgggcggcaccaactcgttgcacaccaacgctttg
gacgagaccctggccctgccgaccgacgagaccgccgagatcgcgctgcgcacccagacc
gtcctgatggaggaaaccggcatcaccaacgtggccgacccgctgggcggctcctggtac
gtcgaagccctcaccgaccgcatcgaggctgaggccgaggcgatcttcacccagatcctc
gccctgggcggcgaatccgacggctcgacggcgggccagaccgcccgcgaggccatgggc
accggccgccacgagatcggcccggtcacctcgggcatcctgcgcggcatcgaggagggc
tggttcacggcgggaatcgccgaggccgccttcacctaccagcagcaactcgaacgcggc
gagaagaagatcgtcggcgtcaactgccacaccgagaccgtggccaaggagctggagatc
ctgcgcatctccggcgacgtggaacgcgaacaggtcgcggcactggccgaccgccgctcc
aaccgcgacaaggacaccgtcgacgcggccctcaaccggatggtccaggtctcccgcacc
gacgacaacatcatccccgcgatgatggacgccgtccgcgtcgaggccaccctcggcgag
atctgcgacgccctgcgcgccgagtggggcgagtaccgcgaacccgcgcggttctag

KEGG   Stackebrandtia nassauensis: Snas_6220Help
Entry
Snas_6220         CDS       T01194                                 

Definition
(GenBank) cobalamin B12-binding domain protein
  KO
K01849  methylmalonyl-CoA mutase, C-terminal domain [EC:5.4.99.2]
Organism
sna  Stackebrandtia nassauensis
Pathway
sna00280  Valine, leucine and isoleucine degradation
sna00630  Glyoxylate and dicarboxylate metabolism
sna00640  Propanoate metabolism
sna01100  Metabolic pathways
sna01120  Microbial metabolism in diverse environments
sna01200  Carbon metabolism
Module
sna_M00741  Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA
Brite
KEGG Orthology (KO) [BR:sna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Snas_6220
   00640 Propanoate metabolism
    Snas_6220
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Snas_6220
Enzymes [BR:sna01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.2  methylmalonyl-CoA mutase
     Snas_6220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: B12-binding DUF1611_N
Motif
Other DBs
NCBI-ProteinID: ADD45841
UniProt: D3Q2U0
LinkDB All DBs
Position
complement(6571455..6571859)
Genome map
AA seq 134 aa AA seqDB search
MESRIRVVVAKPGLDGHDRGAKVVARALRDAGMEVIYTGLHQTPEQIVAAAIAEDAHAVG
LSVLSGAHLTLFKRVTELLAERGASDIVVFGGGIIPDEDIPKLAELGVAKVFTPGATTKS
IVDWVTANVSTTPV
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atggaatcgcgcatccgcgttgtagtggccaaacccggcctggacgggcacgatcgcggt
gccaaggtcgtcgcccgggcgctgcgggacgccggaatggaagtcatctacaccggcctg
caccagacgccggagcagatcgtggccgccgcgatcgccgaggacgcccacgccgtcggg
ctgagtgtcctttcgggagctcacctgacgctgttcaaacgggtcaccgagctgctggcg
gaacggggagcctccgacatcgtcgtgttcggtggcggcatcatccccgacgaggacatt
cccaagctcgccgagctgggagtcgccaaggtgttcacccccggcgccaccacgaaatcc
atagtcgactgggtcaccgccaacgtttccacgacgcccgtgtga

DBGET integrated database retrieval system