KEGG   Stackebrandtia nassauensis: Snas_0782Help
Entry
Snas_0782         CDS       T01194                                 

Definition
(GenBank) Carbamoyl-phosphate synthase L chain ATP-binding protein
  KO
K11263  acetyl-CoA/propionyl-CoA carboxylase, biotin carboxylase, biotin carboxyl carrier protein [EC:6.4.1.2 6.4.1.3 6.3.4.14]
Organism
sna  Stackebrandtia nassauensis
Pathway
sna00061  Fatty acid biosynthesis
sna00280  Valine, leucine and isoleucine degradation
sna00620  Pyruvate metabolism
sna00630  Glyoxylate and dicarboxylate metabolism
sna00640  Propanoate metabolism
sna01100  Metabolic pathways
sna01110  Biosynthesis of secondary metabolites
sna01120  Microbial metabolism in diverse environments
sna01130  Biosynthesis of antibiotics
sna01200  Carbon metabolism
sna01212  Fatty acid metabolism
Module
sna_M00082  Fatty acid biosynthesis, initiation
sna_M00741  Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA
Brite
KEGG Orthology (KO) [BR:sna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Snas_0782
   00630 Glyoxylate and dicarboxylate metabolism
    Snas_0782
   00640 Propanoate metabolism
    Snas_0782
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Snas_0782
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Snas_0782
Enzymes [BR:sna01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     Snas_0782
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     Snas_0782
    6.4.1.3  propionyl-CoA carboxylase
     Snas_0782
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Biotin_lipoyl ATP-grasp Biotin_lipoyl_2 Dala_Dala_lig_C HlyD_3 HlyD_D23 ATP-grasp_3 LAL_C2 ATPgrasp_Ter PucR
Motif
Other DBs
NCBI-ProteinID: ADD40494
UniProt: D3Q7Y9
LinkDB All DBs
Position
complement(827908..829656)
Genome map
AA seq 582 aa AA seqDB search
MRKVLIANRGEIAVRVIRACRDEGMASVAVYSDSDRDALHARLADESYALDGLTAAETYL
RFDKLLDVAARSGADAVHPGYGFLSENADFAQAVIDAGLTWIGPTPRSIRDLGDKVTARH
IAARAGAPLVPGTSEPVSGPDEVIAFADEHGLPIAIKAAFGGGGRGLKVARDRDEIANLY
DSAVREAVASFGRGECFVERYLDKPRHVEAQVLADTHGQVIVVGTRDCSLQRRHQKLVEE
APAPFLTDEQRQRIHDSAKAICREAEYHGAGTVEFLVGADGTISFLEVNTRLQVEHPVSE
ETTGLDLVREQFRIARGEQLALTEDPTPRGHSIEFRINGEDPGRNFLPAPGAVTELRLPS
GPGVRVDTGIDTGAVIDGNFDSLLAKVIVTGATRAEAIERSRRVLSEMVVDGMATALPFH
RAVLDDPAFTSEPFTVHTRWIETEWTNTVEPFAGATELPEPGERDTVVVEVGGKRLEVRL
PAGLGAAPAASGGTKKAPKRGTKRASAAAAGGDALVSPMQGTVVKIEVAEGQTVAEGDTI
VVLEAMKMEQPLTAHKAGTVTGLDATVGDVVSAGAAICEIKA
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcaaggtgttgatagccaaccgaggcgagatcgcggtgcgggtcatccgtgcctgc
cgcgacgaggggatggccagcgtcgccgtctactccgactccgatcgcgacgcgctgcac
gccagactcgccgacgagtcctacgccctggacggcctgaccgccgccgagacctacctg
cgcttcgacaagctgctcgacgtcgccgcccgctccggtgccgacgcggtgcaccccggc
tacggcttcctgtccgagaacgccgacttcgcgcaggccgtcatcgacgcgggcctgacc
tggatcggccccacgccgcgatccatccgcgacctcggcgacaaggtcaccgcccgccac
atcgccgcccgcgccggagccccgctggtgcccggcacgtccgaaccggtctcgggcccc
gacgaggtgatcgccttcgccgacgagcacggcctgccgatcgccatcaaggccgccttc
ggcggcggcggccggggcctgaaggtggcccgcgaccgcgacgagatcgcgaacctctac
gactcggcggtccgcgaggcggtggcgtccttcggtcgcggcgagtgcttcgttgagcgc
tacctggacaaaccccgccacgtcgaggcgcaggtgctggccgacacgcacggccaggtc
atcgtggtcggcacccgcgactgctccctgcaacgccgccaccagaagctggtcgaggaa
gccccggcgcccttcctgaccgacgagcagcggcagcgcatccacgactccgccaaggcc
atctgccgcgaggccgagtaccacggcgccgggaccgtcgagttcctcgtcggcgccgac
ggcaccatctcgttcctggaggtcaacacccggctccaggtcgaacaccccgtctccgag
gagaccaccggtctggacctggtgcgggaacagttccgcatcgcccgcggcgaacaactg
gccctcaccgaagaccccaccccgcgcggccactccatcgagttccgcatcaacggcgag
gacccaggccgcaacttcctgcccgcccccggcgccgtcaccgaactccggctgccctcc
ggcccgggcgtgcgggtcgacaccggcatcgacaccggagccgtcatcgacggcaacttc
gactccctgctggccaaggtcatcgtcaccggcgccacccgcgccgaggccatcgaacgc
tcccgccgagtactgtccgaaatggtggtcgacggcatggccaccgcgctcccgttccac
cgcgcagtcctcgacgaccccgcgttcaccagcgaaccgttcaccgtccacacccgctgg
atcgagacggagtggaccaacaccgtcgaacccttcgccggtgccaccgaactccccgaa
cccggagaacgcgacaccgtcgtggtcgaggtcggcggcaaacgcctcgaggtccggctc
cccgccggtctgggagcggccccggccgcgtccggcggcaccaagaaggcccccaaacgc
ggcaccaaacgcgccagcgccgcggctgccggtggcgacgccctggtctccccgatgcag
ggcactgtcgtcaagatcgaagtcgccgagggccagaccgtcgccgagggcgacaccatc
gtggtgctggaggcgatgaagatggaacagccgctgacggcccacaaggcgggcaccgtc
accggcctggacgccacggtcggcgacgtcgtctccgccggagcggccatctgcgagatc
aaggcctga

KEGG   Stackebrandtia nassauensis: Snas_0792Help
Entry
Snas_0792         CDS       T01194                                 

Definition
(GenBank) carboxyl transferase
  KO
K01966  propionyl-CoA carboxylase beta chain [EC:6.4.1.3 2.1.3.15]
Organism
sna  Stackebrandtia nassauensis
Pathway
sna00280  Valine, leucine and isoleucine degradation
sna00630  Glyoxylate and dicarboxylate metabolism
sna00640  Propanoate metabolism
sna01100  Metabolic pathways
sna01110  Biosynthesis of secondary metabolites
sna01120  Microbial metabolism in diverse environments
sna01130  Biosynthesis of antibiotics
sna01200  Carbon metabolism
Module
sna_M00741  Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA
Brite
KEGG Orthology (KO) [BR:sna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Snas_0792
   00640 Propanoate metabolism
    Snas_0792
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Snas_0792
Enzymes [BR:sna01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     Snas_0792
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.3  propionyl-CoA carboxylase
     Snas_0792
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Carboxyl_trans MdcE
Motif
Other DBs
NCBI-ProteinID: ADD40504
UniProt: D3Q7Z9
LinkDB All DBs
Position
complement(835901..837475)
Genome map
AA seq 524 aa AA seqDB search
MSDIDIHTTAGKLADLAARREAALHAGSARAVDKQHAKGKKTARERIEMLLDEGSFVELD
EMARHRSTNFGLDANRPYGDGVVTGYGTVDGREVCVFAQDFTVFGGSLGEVFGEKIVKVM
DLALKTGRPIIGINDSGGARIQEGVVSLGLYGEIFFRNVRASGVIPQISLVMGPCAGGAV
YSPAITDFTVMVDQTSHMFITGPDVIKTVTGEDVGMEELGGARTHNATSGNAHYLAADED
DAIEYVKSLLTYLPGNNMDEAPVYEADASLEATDEDTALDTIVPDSANQPYDMHAVITAV
LDDAEFCETQPLFAQNIITGFGRIEGHSVGVVANQPMHFAGCLDIDASEKAARFVRTCDA
FNIPIVTFVDVPGFLPGTDQEYNGIIRRGAKLLYAYAEATVPKLTVITRKAYGGAYDVMG
SKHLGADLNFAWPTAQIAVMGAQGAVNILYRRELAEAEDATARRAELITDYEDTLANPYV
AAERGFIDGVIAPSATRAELTKGLRLLRSKRESLPPKKHGNIPL
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
gtgtcggacatcgatatacacaccaccgccggaaagctggccgatctggccgcccgccgc
gaggccgccctgcacgcgggcagcgcccgagccgtcgacaagcagcacgccaagggcaag
aagaccgcccgggaacgcatcgagatgctgctcgacgagggttcctttgtggagctggac
gagatggcccggcaccgttccaccaacttcggcctggacgccaaccggccctacggcgac
ggcgtcgtcaccggttacggcaccgtcgacggccgcgaggtgtgtgtcttcgcacaggac
ttcaccgtcttcggcggctcactgggcgaggtcttcggcgagaagatcgtcaaggtgatg
gacctggcgctcaagaccggccgccccatcatcggcatcaacgactccggcggcgcccgg
atccaggagggcgtggtctcgctgggcctgtacggcgagatcttcttccgcaacgtccgc
gcctccggggtgatcccgcagatctcgctggtcatgggcccgtgcgccggcggcgcggtc
tactcccccgccatcaccgacttcaccgtcatggtcgaccagacctcgcacatgttcatc
accggacccgacgtcatcaagaccgtcaccggcgaggacgtcggcatggaggaactgggc
ggggcccgcacccacaacgccacctccggcaacgcccactacctggccgccgacgaggac
gacgcgatcgagtacgtcaagagcctgctgacctacctgcccggcaacaacatggacgag
gcccccgtctacgaggccgacgccagtctcgaggccaccgacgaggacacggcgctggac
acgatcgtccccgactcggccaaccagccctacgacatgcacgcggtgatcaccgccgtc
ctggacgacgccgagttctgcgagacccagccgctgttcgcccagaacatcatcaccggc
ttcggccgcatcgagggccacagcgtcggcgtcgtcgccaaccagccgatgcacttcgcg
ggctgtctcgacatcgacgcctccgagaaggcggcccggttcgtgcgcacctgcgacgcc
ttcaacatcccgatcgtcaccttcgtcgacgtccccggcttcctgccgggcaccgaccag
gagtacaacggcatcatccggcgcggcgccaaactgctgtacgcctacgccgaggccacc
gtcccgaaactgaccgtcatcacccgcaaggcatacggcggcgcctacgacgtcatgggt
tccaagcacctgggcgccgacctcaacttcgcctggcccaccgcccagatcgcggtcatg
ggcgcgcagggcgcggtcaacatcctctaccggcgcgaactggccgaggccgaggacgcc
accgcccggcgcgccgagctgatcaccgactacgaggacacgctcgcgaacccttacgtg
gcagccgaacgcggcttcatcgacggggtcatcgccccctcggcgacccgggccgaactc
accaagggactgcggctgctgcgctccaaacgtgagtcgctcccgccgaagaagcacggg
aacatcccgctgtaa

KEGG   Stackebrandtia nassauensis: Snas_4812Help
Entry
Snas_4812         CDS       T01194                                 

Definition
(GenBank) carboxyl transferase
  KO
K18472  acetyl-CoA/propionyl-CoA carboxylase carboxyl transferase subunit [EC:6.4.1.2 6.4.1.3 2.1.3.15]
Organism
sna  Stackebrandtia nassauensis
Pathway
sna00061  Fatty acid biosynthesis
sna00280  Valine, leucine and isoleucine degradation
sna00620  Pyruvate metabolism
sna00630  Glyoxylate and dicarboxylate metabolism
sna00640  Propanoate metabolism
sna01100  Metabolic pathways
sna01110  Biosynthesis of secondary metabolites
sna01120  Microbial metabolism in diverse environments
sna01130  Biosynthesis of antibiotics
sna01200  Carbon metabolism
sna01212  Fatty acid metabolism
Module
sna_M00082  Fatty acid biosynthesis, initiation
sna_M00741  Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA
Brite
KEGG Orthology (KO) [BR:sna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Snas_4812
   00630 Glyoxylate and dicarboxylate metabolism
    Snas_4812
   00640 Propanoate metabolism
    Snas_4812
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Snas_4812
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Snas_4812
Enzymes [BR:sna01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     Snas_4812
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     Snas_4812
    6.4.1.3  propionyl-CoA carboxylase
     Snas_4812
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Carboxyl_trans MdcE
Motif
Other DBs
NCBI-ProteinID: ADD44453
UniProt: D3Q8L1
LinkDB All DBs
Position
5107479..5108906
Genome map
AA seq 475 aa AA seqDB search
MSNPTVEAEQEVVDVRDPMPRLTALFDTGTISLLHSGDDSGVVTARGDIAGSPAIAYCSD
ARVKGGAIGIDGGKHIVDAIDTAVRERIPVIGVWHSGGARLAEGVTALHAIGEIFAAMVR
ASGRVPQISVVLGPAAGGAAYGPALTDIVIMSNSGRIFVTGPEVVKSVTGEQSDMETLGG
PDVHGKKSGVAHITTKDDATAFATARDLASLLGRPGRFEAADADDSTDLGALLPEQANRA
YNVKPLVKKLLDSGEGVESPVEMHGKWAASIVTVLGRFAGRTVGVIANNPLKLGGCLNSE
SAEKSARFVRMCDSLGIPLIVLVDVPGYLPGLGQEWDGVVRRGAKLLHAFAESVVPRVTL
VTRKSYGGAYIAMNSRSLGATAVFAWPTAEVAVMGASAAVNVLHRKKLAAVPAEERDALR
EKLIADHENEAGGVSKAIDIGVVDEVIEPSQTRFRIAQALASAPPARGAHGNIPL
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
gtgtctaatccaactgtcgaagccgaacaagaggtcgtcgacgtccgcgacccgatgcct
cggctcacggcgctgttcgacaccggaaccatctcgctgctccacagtggcgatgactcc
ggcgtcgtcacggcgcgcggcgacatcgccggttccccggcgatcgcctactgctccgac
gctcgcgtcaagggcggcgccatcggcatcgacggcggtaagcacattgtggacgccatc
gacaccgcggtgcgggaacggattccggtcatcggggtgtggcactccggcggcgcccgg
ttggccgagggtgtcacggccctgcacgccatcggtgagatcttcgccgcgatggtgcgg
gcctcggggcgggtaccgcagatctcggtggtgctgggcccggccgcgggtggcgcggcc
tacggtccggcgctgaccgacatcgtcatcatgtccaactccggccgcatcttcgtgacc
ggcccggaggtcgtcaagagcgtcaccggcgaacagtccgacatggagacactgggcgga
ccggacgtgcacggcaagaagtccggcgtcgcccacatcaccaccaaggacgacgcgacg
gccttcgccactgcccgcgacctggcctcgctgctgggtcgtccgggccggttcgaggcc
gccgacgccgacgactcgaccgacctgggcgcgctgctccccgagcaggccaaccgcgcc
tacaacgtcaagccgctggtgaagaagctgctggactccggtgagggtgtggagtcgccg
gtggagatgcacggcaagtgggccgccagcatcgtcacggtgctgggccggttcgccggt
cgcaccgtcggcgtcatcgccaacaacccgctcaagctcggcggctgcctcaactccgag
agcgccgagaagtcggcgcgcttcgtgcggatgtgcgactcgctgggcatcccgctgatc
gtgctggtcgacgtccccggctacctgccgggcctcggccaggagtgggacggcgtggtc
cgtcgcggcgcgaaactgctgcacgccttcgccgagtccgtggtcccccgggtcaccctg
gtgacgcgcaagtcctacggcggcgcctacatcgcgatgaactcgcgatcccttggcgcg
acggcggtcttcgcgtggccgacggccgaagtggcggtcatgggcgcctcggcggcggtc
aacgtcctgcaccgcaagaagctcgccgcggtccccgcggaagagcgggacgccttgcgc
gagaagctgatcgccgaccacgagaacgaggcgggcggcgtgtcgaaggccatcgacatc
ggtgtcgtcgacgaggtcatcgagccgtcccagacgcggttccgcatcgcccaggcgctg
gccagcgctcccccggcgcgcggcgcccacggcaacatcccgctgtag

DBGET integrated database retrieval system