KEGG   Stackebrandtia nassauensis: Snas_0839Help
Entry
Snas_0839         CDS       T01194                                 

Definition
(GenBank) fumarate lyase
  KO
K01679  fumarate hydratase, class II [EC:4.2.1.2]
Organism
sna  Stackebrandtia nassauensis
Pathway
sna00020  Citrate cycle (TCA cycle)
sna00620  Pyruvate metabolism
sna01100  Metabolic pathways
sna01110  Biosynthesis of secondary metabolites
sna01120  Microbial metabolism in diverse environments
sna01200  Carbon metabolism
Module
sna_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sna_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Snas_0839
   00620 Pyruvate metabolism
    Snas_0839
Enzymes [BR:sna01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.2  fumarate hydratase
     Snas_0839
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lyase_1 FumaraseC_C ADSL_C
Motif
Other DBs
NCBI-ProteinID: ADD40551
UniProt: D3Q846
LinkDB All DBs
Position
885566..886960
Genome map
AA seq 464 aa AA seqDB search
MAESNEVRVEHDTMGEVKVPAWAAWRAQTQRAVENFPISGVRLERTQIKALALIKGAAAR
VNAELGVLDSHIAEAIAEAAAEVAKGTYDEHFPLDVFQTGSGTSSNMNANEVIATLASAR
CGVEVHPNDHVNASQSSNDVFPSSMHIAATDGVMNDLVPALAVLEGALAAKATEFADVVK
SGRTHLMDATPVTLGQEFAGYAAQIRNGVDRLTSALPRVAELPLGGTAVGTGINTPRGFA
AGVIARLADETGLPLTEARDHFEAQGARDGLVELSGQLRTIAVGMTKIANDIRWMGSGPR
AGLSELRLPDLQPGSSIMPGKVNPVLCEAVRQVAAQVIGNDAAIAFSGASGDFELNVMLP
VMARNVLESIRLLANVSRLFGERCVAGLEADAERCLEYAEGSPSIVTPLNRYLGYEEAAS
IAKQALAERVSIREVVVARGHVEAGKLTEEQLDEALDVRRMTGN
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atggctgaatcgaatgaggtccgcgtcgaacacgacaccatgggcgaggtcaaggtgccc
gcgtgggcggcgtggcgagcgcaaacccaacgcgccgtagagaacttcccgatctcgggc
gtgcggttggaacggacccagatcaaggccctggccctcatcaagggcgcggcggcccgg
gtgaacgcggaacttggcgtgctggactcccacatcgccgaggcgatcgccgaggcggcg
gccgaggtcgccaagggcacctacgacgagcacttcccgctggacgtcttccagaccggt
tcgggcacgtcgtccaatatgaacgccaacgaggtgatcgcgacgctggccagcgcccgc
tgcggcgtcgaggtgcatcccaacgaccacgtcaacgcgtcccagtcctcaaacgacgta
ttcccgtcctcaatgcacatcgccgcgacggacggggtgatgaacgatctggtcccggcg
ctggcggtgctggagggggcgctggcggccaaggcgaccgagttcgccgacgtcgtcaag
tcggggcgcacccacctcatggacgccaccccggtgacgctgggccaggagttcgccggc
tacgccgcccagatccgcaacggggtcgaccggctgacgtcggcgctgccccgggtggcc
gagctgccgctgggcggcaccgccgtgggtaccggcatcaacaccccgcgcggcttcgcc
gccggtgtgatcgcccggctcgccgacgagaccggcctgccgctgaccgaggcccgcgac
cacttcgaggcgcagggcgcccgcgacggcctcgtcgagctgtcgggtcagctgcgcacc
atcgcggtggggatgaccaagatcgccaacgacatccgctggatgggctccggcccccgg
gccgggctgtcggaactgcggttgccggacctgcaaccgggatcgtccatcatgcccggc
aaggtcaacccggtgctgtgcgaggcggtgcggcaggtggccgcgcaggtgatcggcaac
gacgccgcgatcgccttcagtggagcgtcgggcgacttcgagctgaacgtgatgctgccg
gtgatggcccgcaacgtcctggagtcgattcgcttgctggccaacgtttcccgactgttc
ggcgaacgctgtgtcgccgggctggaggccgacgccgagcggtgcctggagtacgccgag
ggctcaccgtccatcgtgacgccgctgaaccgctacctcggctacgaggaggccgcctcg
atcgccaagcaggcgctggccgaacgggtctcgatccgcgaggtcgtggtggcccgcggc
cacgtcgaggccgggaaactcaccgaggaacagctggacgaggcgctcgacgtccgtcgc
atgaccgggaactga

KEGG   Stackebrandtia nassauensis: Snas_6383Help
Entry
Snas_6383         CDS       T01194                                 

Definition
(GenBank) hydro-lyase, Fe-S type, tartrate/fumarate subfamily, beta subunit
  KO
K01676  fumarate hydratase, class I [EC:4.2.1.2]
Organism
sna  Stackebrandtia nassauensis
Pathway
sna00020  Citrate cycle (TCA cycle)
sna00620  Pyruvate metabolism
sna01100  Metabolic pathways
sna01110  Biosynthesis of secondary metabolites
sna01120  Microbial metabolism in diverse environments
sna01200  Carbon metabolism
Module
sna_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sna_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Snas_6383
   00620 Pyruvate metabolism
    Snas_6383
Enzymes [BR:sna01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.2  fumarate hydratase
     Snas_6383
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fumerase_C Fumerase Histone_H2A_C
Motif
Other DBs
NCBI-ProteinID: ADD45999
UniProt: D3Q5D9
LinkDB All DBs
Position
complement(6733316..6734959)
Genome map
AA seq 547 aa AA seqDB search
MSDDFAYTDLLPLGSDDTEYRHLGTEGVEVVEAAGRRLLTVDGDALSRLAAEAMHDISHL
LRPAHLRQLASILDDPEASGNDKFVALDLLKNANIAAGGVLPMCQDTGTAIVMGKRGRHV
LTDGRDAEHLSCGVYRAYRDLNLRYSQMAPLNMWDEKNTGTNLPAQVELYAEGDDAYKFL
FMAKGGGSANKSFLYQETKAVLNPTRMMQFLEEKLRALGTAACPPYHLAIVVGGTSAEFA
LKTAKYASAHYLDTLPTTGSESGHGFRDLDLEKQVLELTRQFGIGAQFGGKYFCHDVRVV
RLPRHGASCPVAIAVSCSADRQMLGKVTAEGLFLEKLEKDPARYLPDTTGEDLGGDVVQV
DLNRPMDEIRAELSRYPVKTRLSLTGPLVVARDIAHAKIAERLDAGEAMPQYLRDHAVYY
AGPAKTPAGYASGSFGPTTAGRMDSYVERFQAAGGSLVMLAKGNRSKQVTDACQAHGGFY
LGSIGGPAARLAKDCIKSVEVLEYPELGMEAVWKIEVADFPAFIVVDDKGNDFFAKTSKP
TLTISTR
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacgacttcgcctataccgacctgcttcccctcgggtccgacgacaccgagtac
cggcacctgggtaccgagggtgtcgaggtggtggaggccgcgggccgcaggctgctgacc
gtcgacggcgacgccctgtcccggttggccgctgaggccatgcacgacatctcgcacctg
ctgcgccccgcgcacctgcggcagctcgcgtcgatcctcgacgaccccgaggcctccggc
aacgacaagttcgtcgcgctggacctgctgaagaacgccaacatcgccgccggtggcgtg
ctgccgatgtgccaggacaccggaaccgcgatcgtcatgggcaaacggggacgccacgtc
ctcaccgacggccgcgacgccgaacacctcagctgcggcgtctatcgcgcctaccgcgac
ctgaacctgcggtactcgcagatggcaccgctgaacatgtgggacgagaagaacaccggc
acgaacctgcccgcccaggtcgagctgtacgccgagggcgacgacgcctacaagttcctg
ttcatggccaagggcggcggcagtgccaacaagtcgttcctgtaccaggagaccaaggcc
gtgttgaatccgacgcggatgatgcagttcctggaggagaagctgcgcgccctgggcacc
gcggcctgcccgccctaccacctggccatcgtggtgggcggcaccagcgccgagttcgcc
ctcaagaccgccaagtacgcctcggcgcactacctggacacgctgccgaccaccggatcc
gagtccgggcacggcttccgggacctggacttggagaagcaggtgctggagctgacccgg
cagttcggcatcggcgcccagttcggcggcaagtacttctgccacgacgtgcgcgtcgtc
cggctgccgaggcacggcgcctcctgtccggtcgcgatcgcggtgtcctgttcggccgac
cggcagatgctcggcaaggtcaccgccgagggactgttcctggagaagctcgagaaggac
ccggcccggtacctgcccgacaccaccggcgaggacctcggcggcgacgtcgtccaggtc
gacctgaaccggcccatggacgagatccgcgccgaactgtcgcgctacccggtcaagacc
cggctgtcgctgaccggcccgctggtcgtggcccgcgacatcgcgcacgccaagatcgcc
gaacggctcgacgcgggcgaggcgatgccgcagtacctgcgcgaccacgccgtctactac
gccggtcccgccaagacccccgccggttacgcctccggctccttcggccccaccaccgcc
ggacggatggactcctacgtggagcggttccaggcggcgggcggctcgctggtcatgctg
gccaagggaaaccgttccaaacaggtcaccgacgcctgccaggcccacggcggcttctac
ctcggctcgatcggcggcccggccgcccggctggccaaggactgcatcaaatccgttgag
gtgcttgaatacccggagctgggcatggaggcggtgtggaagatcgaggtcgccgacttc
ccggccttcatcgtcgtggacgacaagggcaacgacttcttcgccaagacctccaagccg
accctgacgatcagcacccgctga

DBGET integrated database retrieval system