KEGG   Stackebrandtia nassauensis: Snas_0866Help
Entry
Snas_0866         CDS       T01194                                 

Definition
(GenBank) Spermine synthase
  KO
K00797  spermidine synthase [EC:2.5.1.16]
Organism
sna  Stackebrandtia nassauensis
Pathway
sna00270  Cysteine and methionine metabolism
sna00330  Arginine and proline metabolism
sna00410  beta-Alanine metabolism
sna00480  Glutathione metabolism
sna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sna00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Snas_0866
   00330 Arginine and proline metabolism
    Snas_0866
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Snas_0866
   00480 Glutathione metabolism
    Snas_0866
Enzymes [BR:sna01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.16  spermidine synthase
     Snas_0866
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Spermine_synth Methyltransf_25 MTS Methyltransf_11
Motif
Other DBs
NCBI-ProteinID: ADD40577
UniProt: D3Q8W8
LinkDB All DBs
Position
914621..916168
Genome map
AA seq 515 aa AA seqDB search
MSSVSRGKLARTGLLATVFICAACGLVYELALVALGSYLIGNTAQQASIVLGLMVFAMGA
GALAAKPLQKRAAAAFALIELLLALFGGLSVIALYAAFAWLHLYTVAMVGVALLLGVLIG
AEIPLLMVLLQRLRKQSAGSAVADLFAADYIGALLGGLAFPFLLLPVFGQIKGALIVGAV
NALAGLILVFTLFRRDLRRRTRWIVGGFAALVAVTLVGGYAYAGRFEAEAQQALYANPIV
YSEQTQYQRIVMTQSISPFRDTDTRLYLNGDLQFSSVDEYRYHEALVHPALAGDRDDVLV
LGGGDGLALREILEYPDVENVTLVELDPAMTDLARDNPVLNRLNGDAFADPRVDTVNADA
FNWLRGNTGRYDAIIVDMPDPDETATAKLYSVEFYGLASRLLAKDGRMAVQSGSPYFAPK
SFWCVNKTLKEAGTKPVPYHVTVPSFGDWGFNLVGAKSTPELALDPPGDLKSLDGPTLDA
ATVFPPDRPERDVPASTLMDPVILEYAQSEWDSYG
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcagtttcacgggggaaactggcacgcacgggcctgctggcgacggtgttcatc
tgcgccgcctgcggtctggtctacgaactggcgctggtcgcgctgggcagctacctgatc
ggcaacaccgcccagcaagcgtccatagtgctgggtctgatggtcttcgccatgggcgcg
ggcgccctggcggccaaaccgctgcagaaacgcgccgccgcggccttcgctctcatcgaa
ctgctgctggccctgttcgggggcctgagcgtcatcgccctgtacgccgccttcgcctgg
ctgcacctgtacacggtggccatggtcggggtggcgctgttgctgggcgtcctcatcggc
gccgagattccactgttgatggtcctgcttcagcggctgcgcaagcaatccgcgggcagc
gccgtggccgacctgttcgccgctgactacatcggcgccctgctcggcggactggccttc
ccgttcctgctgctgccggtcttcggccagatcaagggcgccctgatcgtcggcgccgtc
aacgccctggccgggctcatcctcgtgttcacgctgttccgtcgcgacctgcggcgccgc
acccgctggatcgtcggcggcttcgccgccctggtcgccgtcaccctggtcggcggctac
gcgtacgcgggccgcttcgaggccgaagcccagcaggccctgtacgccaaccccatcgtc
tacagcgaacagacgcagtaccagcgcatcgtgatgacgcagtcgatctcgccgtttcgc
gacaccgacactcgcctctatctcaacggcgacctacagttctcctcagtggacgaatac
cggtaccacgaggccctggtccacccggcgctcgccggtgaccgcgacgacgtcctcgtc
ctgggcggcggtgacggcctggccctgcgcgagatcctcgaataccccgacgtcgagaac
gtgaccctcgtcgaactcgacccggcgatgaccgatctggcccgcgacaacccggtcctc
aaccggctcaacggcgacgccttcgccgacccccgcgtcgacaccgtcaacgccgacgcg
ttcaactggctgcgcggcaacaccggccgctacgacgcgatcatcgtcgacatgcccgac
cccgacgagaccgccacggccaagctgtactcggtggagttctacggcctggcttcccgg
ctgctggccaaggacggccggatggctgtccaatcaggatccccgtacttcgcgccgaag
tcgttctggtgcgtcaacaagacgctcaaagaggccggaaccaaacccgtcccgtaccac
gtgaccgtgcccagcttcggcgactggggcttcaacctggtcggggcgaagtccacacct
gagctcgcactcgacccgcccggggacctgaagtccctggacgggccgacccttgacgcg
gccaccgtcttcccgcccgaccgccccgaacgcgacgtcccggcgtccacgctcatggac
cccgtcatcctcgagtacgcgcagtccgaatgggacagctacggctga

DBGET integrated database retrieval system