KEGG   Stackebrandtia nassauensis: Snas_0873Help
Entry
Snas_0873         CDS       T01194                                 

Definition
(GenBank) acetate/CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sna  Stackebrandtia nassauensis
Pathway
sna00010  Glycolysis / Gluconeogenesis
sna00620  Pyruvate metabolism
sna00630  Glyoxylate and dicarboxylate metabolism
sna00640  Propanoate metabolism
sna00680  Methane metabolism
sna01100  Metabolic pathways
sna01110  Biosynthesis of secondary metabolites
sna01120  Microbial metabolism in diverse environments
sna01130  Biosynthesis of antibiotics
sna01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Snas_0873
   00620 Pyruvate metabolism
    Snas_0873
   00630 Glyoxylate and dicarboxylate metabolism
    Snas_0873
   00640 Propanoate metabolism
    Snas_0873
  09102 Energy metabolism
   00680 Methane metabolism
    Snas_0873
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sna01004]
    Snas_0873
Enzymes [BR:sna01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Snas_0873
Lipid biosynthesis proteins [BR:sna01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Snas_0873
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ADD40584
UniProt: D3Q8X5
LinkDB All DBs
Position
921352..923319
Genome map
AA seq 655 aa AA seqDB search
MNETPKSQETLANLLNETRHFDPPAEFAAQATVTADEYDRAGADRLAFWESKAERLHWAA
KWDRTLDWDNPPFAKWFVGGKLNVAYNCLDRHVEAGNGDRVAIHWEGEPGDTRTITYAEL
TSEVKKAANALTALGVTAGDRVAIYMPMIPEAAMAMLACARIGATHSVVFGGFSVAALSG
RIQDADAKVVITADGGYRRGKPSDLKGIVDDSVAQCPSVEKVLVVRRTGSDVAWTDKDLW
WHDVVDSASDEHEAQPFDAEHPLFILYTSGTTAKPKGILHTSGGYLTQASYTHQAVFDIK
PDNDIYWCTADIGWVTGHSYIVYGPMSNGVTQVMYEGTPDTPHKGRFWELVQKYRITQIY
TAPTAIRTFMKWGDDIPAGFDLSSLRVLGSVGEPINPEAWMWYRKHIGGDRCPVVDTWWQ
TETGAMMISPLPGVTSTIPGSAQTPLPGISADVVDDEGKSVPNGGGGYLVLREPWPSMLR
TIWGDDQRFLDTYWSKFDNMYFAGDGAKRDADGNIWLLGRVDDVMLVSGHNISTTEVESA
LVSHPKVAESAVVGATDPVTGQGIVAFTILRGDADGGEELMTELRNHVAKELGPIAKPRQ
IMVVPELPKTRSGKIMRRLLRDVAENRSLGDVTTLQDSAVMDLISKGMSSGKDED
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgagaccccgaagtcgcaagagactctcgctaatctgctcaacgagacgcggcat
ttcgacccgcccgcggaattcgccgcccaggctaccgtcaccgctgacgagtacgaccgc
gcgggtgccgaccggctggcgttctgggaatcgaaagccgagcgcttgcactgggccgcc
aagtgggaccggacccttgactgggacaacccgccgttcgcgaagtggttcgtcggcggc
aagctcaacgtcgcctacaactgtctggaccggcacgtcgaggccggaaacggcgaccgg
gtggcgatccactgggagggcgagccgggcgacacccgcaccatcacctacgccgagctg
accagcgaggtcaagaaggccgccaacgcgctcaccgcgctgggcgtcaccgccggggac
cgggtcgccatctacatgccgatgatccccgaagcggcgatggcgatgctggcctgcgcc
cgcatcggcgccacccactcggtggtcttcggcggcttcagcgtcgcggcgctgtcgggc
cggatccaggacgctgacgccaaggtcgtcatcaccgccgacggcggctaccggcgcggc
aagcccagcgacctcaagggcattgtggacgattcggtggcgcagtgtccgtcggtggag
aaggtgctcgtggtgcgccgcaccggctccgacgtcgcctggaccgacaaggacctgtgg
tggcacgacgtggtcgactccgcgtcggacgaacacgaggcgcagcccttcgacgccgag
cacccgctgttcatcctctacacgtcgggaaccaccgccaagcccaagggcatcctgcac
acctccggcggctacctgacccaggcctcatacacccaccaggccgtgttcgacatcaag
cccgacaacgacatctactggtgcaccgccgacatcggctgggtcaccggccactcgtac
atcgtgtacggtccgatgtcgaacggcgtcacgcaggtcatgtacgagggcacccccgac
acgccccacaagggacgtttctgggaactggtgcagaagtacaggatcacccagatctac
accgcgcccaccgcgatccgcaccttcatgaagtggggcgacgacatcccggccgggttc
gacctgtcgagcctgcgggtcctgggttcggtgggcgagcccatcaaccccgaggcgtgg
atgtggtatcgcaagcacatcggcggcgaccgctgcccggtcgtggacacctggtggcag
accgagaccggcgcgatgatgatctcgccgctgccgggcgtcacctccacgatccccggc
tcggcccagaccccgctgccgggcatcagcgccgacgtcgtcgacgacgagggcaagtcg
gtgcccaacggcggcggtggctacctggtgctgcgcgagccgtggccgtccatgcttcgc
accatctggggcgacgaccaacgcttcctcgacacctactggtccaagttcgacaacatg
tacttcgccggtgacggcgccaaacgcgatgccgacggcaacatctggctgttgggccgc
gtcgacgacgtcatgctcgtgtccggccacaacatctcgaccaccgaggtcgaatcggcc
ctggtctcgcacccgaaggtcgccgagtcggcggtcgtcggcgccaccgacccggtcacc
ggccagggcatcgtggcgttcacgatcctgcgcggcgacgcggacggcggcgaggaactg
atgaccgaactgcgcaaccacgtcgccaaggaactcggcccgatcgccaagccgcgccag
atcatggtcgtccccgagctccccaagacccgctcgggcaagatcatgcgccgcctgctg
cgcgacgtcgccgagaaccgttccctgggcgacgtgacgacgctccaggactcggccgtc
atggacctcatctccaagggcatgtcctccggcaaggacgaggactga

KEGG   Stackebrandtia nassauensis: Snas_2842Help
Entry
Snas_2842         CDS       T01194                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sna  Stackebrandtia nassauensis
Pathway
sna00010  Glycolysis / Gluconeogenesis
sna00620  Pyruvate metabolism
sna00630  Glyoxylate and dicarboxylate metabolism
sna00640  Propanoate metabolism
sna00680  Methane metabolism
sna01100  Metabolic pathways
sna01110  Biosynthesis of secondary metabolites
sna01120  Microbial metabolism in diverse environments
sna01130  Biosynthesis of antibiotics
sna01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Snas_2842
   00620 Pyruvate metabolism
    Snas_2842
   00630 Glyoxylate and dicarboxylate metabolism
    Snas_2842
   00640 Propanoate metabolism
    Snas_2842
  09102 Energy metabolism
   00680 Methane metabolism
    Snas_2842
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sna01004]
    Snas_2842
Enzymes [BR:sna01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Snas_2842
Lipid biosynthesis proteins [BR:sna01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Snas_2842
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ADD42517
UniProt: D3Q8E3
LinkDB All DBs
Position
2989940..2991640
Genome map
AA seq 566 aa AA seqDB search
MNVTDAYRASRDQLLDLRGDHERAVAEFQWPDMGERFNWAVDWFDVIARGNDGTALLLAE
ADGSTTRRSFAEMSQASDRLAGWLAERGVGKGDPVVLMLGNQVELWESMLAVMKLGAVIM
PTTTAVGPADLVDRISRGGARHVICNAADVPKFDAVPGEYTRISVGEAAGWQDLRSTAAV
SHAPVDHPGTAPGDPLLLYFTSGTTSRPKLVGHTQVSYPVGHLSTMYYLGLEPGDVHLNI
SSPGWAKHAWSCFFAPWIAEATVFVYNYQRFDAVALLRQLREQRVTSFCAPPTVWRMLIN
AELGERPADLREAVAAGEPLNPEVIEQVRQAWGLTIRDGFGQTETTAQVGNTPGSPVKPG
SMGRPLPGVPVVLVDPATGRRVEAPGEGEICLDLDRKPLPLMTGYQGDRELNAEAMSGGF
YHSGDVAKIDADGYITYIGRTDDVFKASDYKISPFELESVLIEHPAVAEAAVVPAPDPVR
LAVPKAYIALAPGHSPTQETARSILRYARENLAPYQRVRRIEFRELPKTISGKIRRVELR
SREEQLGNDSGADGEWRDDQFPELKG
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtgacggatgcgtaccgggcgagccgtgaccagttgctggatctgcgcggtgac
catgagcgcgcggttgccgagttccagtggcccgatatgggggagcggttcaattgggcc
gtggactggttcgacgtcatcgctcgcggcaacgacggtacggctttgttgctggccgag
gcggacggttcgacgacgcggcgaagcttcgccgagatgtcccaggcatccgaccggctg
gccggttggcttgcggagcgcggtgtcggcaagggcgatccggtggtgctgatgctcggc
aaccaggttgaactgtgggagtcgatgctcgcggtcatgaagttgggcgcggtgatcatg
ccgaccacgaccgcggtcggcccggcggacctggttgaccggatcagccggggcggtgcc
cggcacgtcatctgcaacgcggcggacgtgccgaagttcgatgccgtgcccggtgagtac
accaggatcagtgtgggtgaggccgcgggatggcaggacttgcgtagtaccgcagcggtt
tcgcacgcgccggtggatcaccctggtacggcgcctggcgatccgttgctgctgtacttc
acgtcgggaaccacgtcgcggccgaagctggtggggcacactcaggtctcctacccggtg
ggccatctgtctactatgtactacttggggcttgaacccggcgatgtgcatctgaacatc
tcctcgccgggatgggccaagcacgcgtggtcgtgcttcttcgcgccgtggatcgccgag
gcgacggtgttcgtgtacaactaccagcgattcgacgccgtagcgctgctgcgccagctc
cgcgagcagcgggtcacgtcgttctgcgcgccgccgacggtgtggcggatgctgatcaac
gccgagctcggggagcggccagccgacctgcgcgaggccgtcgcggctggcgagccactc
aatccggaggtgatcgagcaggttcgccaggcgtgggggctgaccatccgggacgggttc
gggcagaccgagaccaccgcccaggtcggcaacaccccgggatccccggtgaagccgggc
tcgatgggccgaccactgccgggcgtcccggtggtcctggtcgacccggccaccgggcgt
cgcgtggaagcccccggcgagggcgagatctgccttgacctcgaccggaaaccgctgccg
ttgatgaccggctatcaaggtgaccgcgaactcaacgccgaggcgatgtccggcggcttc
taccactccggggacgtggccaagatcgatgccgacgggtacatcacctacatcggacgc
accgacgacgtgttcaaggccagcgactacaagatcagccccttcgagctggagtcggtg
ctcatcgagcacccggcggtcgccgaggcggccgtggttccggctcccgatccggtgagg
ttggcggttcccaaggcatacatcgcgctggcaccggggcattcgcccacacaggagacc
gcgcgatcgatcctgcgttacgcccgcgagaatctcgcgccgtaccaacgcgtccgtcgc
atcgagtttcgcgagctgcccaagacgatctccggcaagatccgccgcgtcgagctgcgt
tcccgcgaagaacaactgggcaacgactcaggagccgacggcgaatggcgcgacgaccag
ttccccgagctcaaggggtga

KEGG   Stackebrandtia nassauensis: Snas_3465Help
Entry
Snas_3465         CDS       T01194                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sna  Stackebrandtia nassauensis
Pathway
sna00010  Glycolysis / Gluconeogenesis
sna00620  Pyruvate metabolism
sna00630  Glyoxylate and dicarboxylate metabolism
sna00640  Propanoate metabolism
sna00680  Methane metabolism
sna01100  Metabolic pathways
sna01110  Biosynthesis of secondary metabolites
sna01120  Microbial metabolism in diverse environments
sna01130  Biosynthesis of antibiotics
sna01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Snas_3465
   00620 Pyruvate metabolism
    Snas_3465
   00630 Glyoxylate and dicarboxylate metabolism
    Snas_3465
   00640 Propanoate metabolism
    Snas_3465
  09102 Energy metabolism
   00680 Methane metabolism
    Snas_3465
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sna01004]
    Snas_3465
Enzymes [BR:sna01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Snas_3465
Lipid biosynthesis proteins [BR:sna01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Snas_3465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ADD43129
UniProt: D3PVL5
LinkDB All DBs
Position
3665074..3666870
Genome map
AA seq 598 aa AA seqDB search
MKPPAEDRELHGHPPIHKTREFAVSPNLQSYPDTYKSFDWDVARDWLSGLPGGRGLNIAH
EAVDRHADGPLADKLAIRCVDRTGAVTDINYTELKAATGRFANVLRRLGVGSGDRVFSLL
GRIPELYVTALGTLKNTSVFSPLFPAFGPEPIHDRLVLGDARVLVTSTELYTRKIARIRD
RIPSLEHVLVVGEPVEGTEDLEQLMFEVDEDFEIPDTDPESMALLHFTSGTTGKPKGAVH
VHEALLAHYASARYALDLHPDDVFWCTADPGWVTGTSYGIIAPLAHGATLLTDAAEFDAK
RWYRMLADNRVSVWYTAPTAIRMLMRQNPELAARHDLSALRFVASVGEPLNPEAVVWGQR
VLGLPIHDNWWQTETGAIMISNYVAMDIRPGSMGRPLPGVEAGLLRRGEDGRALVTDGRV
EVPTEADQIGELALRTGWPSMFRGYLHEPRRYEHCFADGWYLSGDVARRDADGYYWFVAR
ADDVIKSAGHLIGPFEVESVLMEHPAVAEAGVIGKPDPVAGNLVKAFVSLRPGVEPDDQL
RLDVMGFARKRLGGLAPKEITFQANLPHTRSGKVMRRLLKARELGLAEGDLSTLEGSS
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccgccagccgaggaccgggaactccatggtcatccgcccatccacaagacccgt
gagttcgccgtctccccgaatctgcagtcatatcccgacacctacaagtcctttgactgg
gacgtcgcccgcgactggctgtccgggcttccgggcggccgcggtctcaacatcgcccat
gaggcggtggaccggcacgccgacggtcccctcgccgacaagctcgcgatccgctgcgtg
gatcgaaccggcgccgtcaccgacatcaactacacggagctgaaggccgccaccggccgc
ttcgccaacgtgctgcgacgtctgggagtgggatccggcgaccgggtgttctccctgctc
ggccggataccggagctctacgtcaccgccctgggaacgctgaagaacaccagcgtcttc
tcgccactgttcccggccttcggccccgaaccgatccatgaccgcctggtactgggtgac
gcgcgcgtcctggtgaccagcaccgagctctacactcgcaagatcgcgcgtatccgcgac
cggattcccagtctggaacacgtcctcgtcgtcggtgaaccggtggaggggaccgaggat
ctcgaacaactgatgttcgaagtggacgaggacttcgagatccccgacaccgatccggag
tcgatggcgctgctgcacttcaccagcggcaccacgggcaaacccaagggcgccgtccac
gtacacgaggcgctgttggcgcactacgcctccgcccggtacgccctcgacctgcatccg
gacgacgtgttctggtgcaccgccgatccgggctgggtgaccggaacgtcctacggcatc
atcgcgccgctcgcgcacggcgccaccctgctgaccgacgccgccgagttcgacgccaag
cgttggtatcgcatgctcgccgacaaccgggtcagtgtctggtacaccgctcccacggcc
atccgcatgctcatgcggcagaacccggagctggccgctcgacatgacctgtcggcgttg
cggttcgtcgccagcgtcggtgaaccgctcaaccccgaggccgtggtctggggacagcgg
gtcctgggtctgccgatccacgacaactggtggcagaccgagaccggcgccatcatgatc
agcaactacgtggccatggacatccgccccggttcgatgggacgcccgctgccaggggtg
gaggcgggcctgttgcgtcgcggtgaggacgggcgggcactggtgaccgacggccgggtc
gaggttccgaccgaggcggaccagatcggtgagctcgcgctgcgaaccgggtggccgtcc
atgttccgcggttacctgcacgagccgcgacggtacgaacactgcttcgccgacggctgg
tacctgtcgggtgatgtcgccaggcgcgacgccgacggctactactggttcgtcgcacgc
gccgacgacgtcatcaagtccgccggtcacctcatcggaccgttcgaagtggagagtgtc
ctgatggagcatccggccgtggccgaggcgggagtcatcggcaaacccgatccggtcgcc
ggaaacctggtgaaggcgttcgtgtcgctgcggccgggagtcgaacccgacgaccagctt
cggctggacgtgatgggtttcgcccgcaaacggctgggaggcttggcgcccaaggagatc
acattccaggcgaacctgcctcacacccgcagcggcaaggtgatgcggcgcctgctcaag
gcccgcgaactcggactggccgaaggtgatctgtctaccttggagggatcgtcgtga

DBGET integrated database retrieval system