KEGG   Stackebrandtia nassauensis: Snas_0957Help
Entry
Snas_0957         CDS       T01194                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sna  Stackebrandtia nassauensis
Pathway
sna00071  Fatty acid degradation
sna00072  Synthesis and degradation of ketone bodies
sna00280  Valine, leucine and isoleucine degradation
sna00310  Lysine degradation
sna00362  Benzoate degradation
sna00380  Tryptophan metabolism
sna00620  Pyruvate metabolism
sna00630  Glyoxylate and dicarboxylate metabolism
sna00640  Propanoate metabolism
sna00650  Butanoate metabolism
sna00900  Terpenoid backbone biosynthesis
sna01100  Metabolic pathways
sna01110  Biosynthesis of secondary metabolites
sna01120  Microbial metabolism in diverse environments
sna01130  Biosynthesis of antibiotics
sna01200  Carbon metabolism
sna01212  Fatty acid metabolism
sna02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Snas_0957
   00630 Glyoxylate and dicarboxylate metabolism
    Snas_0957
   00640 Propanoate metabolism
    Snas_0957
   00650 Butanoate metabolism
    Snas_0957
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Snas_0957
   00072 Synthesis and degradation of ketone bodies
    Snas_0957
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Snas_0957
   00310 Lysine degradation
    Snas_0957
   00380 Tryptophan metabolism
    Snas_0957
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Snas_0957
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Snas_0957
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Snas_0957
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sna04147]
    Snas_0957
Enzymes [BR:sna01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Snas_0957
Exosome [BR:sna04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Snas_0957
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ADD40667
UniProt: D3Q958
LinkDB All DBs
Position
complement(1014028..1015272)
Genome map
AA seq 414 aa AA seqDB search
MTEAVIVATARTPIGRAVKGSLKDLRPDDLAATAVRAALDKVPDLDPAIIDDLYLGCGLP
GGEAGFNMGRVVSVLLGYDHLPAATLTRYCASSLQTTRMAAHAIKAGEGDVFISAGVEAV
SRYGRGNSDGLPEPVQAQVGGGWQNPVFDAARERSAHRAENGAVGWDDPRESGEVPDIYL
AMGQTAENLALARGVTRAEMDAFGVRSQNLAEKAIADGFWAEEITPVTLPDGTVVATDDG
PRAGVTLEAVSGLKPVFRPDGRVTAGNCCPLNDGAAAVIVMSDTKAAELGITPLARIVST
GVTAMSPEIMGIGPVEASWQALARAGLGIDDMDLVEINEAFAAQVIPSYQDLGVPLEKLN
VHGGAIAVGHPFGMTGARITGTLLHGLQRTGGRYGLETMCVGGGQGMAMVIERL
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgactgaagccgtcatcgtcgcgaccgcccgcactcccatcgggcgcgccgtcaagggt
tccctgaaggatctgcgtccggacgacctggccgccacggcggtgcgcgccgcgctggac
aaggtgccggatctggatccggccatcatcgacgacctgtacctgggttgcggactgccc
ggcggtgaggccggtttcaacatgggccgggtggtgtccgtcctgttgggatacgaccac
ctgcccgccgcgacgctcacccgctactgcgcctcgtcgctgcagacgacccggatggcc
gcgcacgcgatcaaggccggtgagggtgacgtgttcatctccgccggggtggaggccgtg
tcgcggtacgggcgcggcaattccgacggcctgccggaaccggtgcaggcgcaggtgggc
ggcggctggcagaacccggtcttcgacgcggcccgcgagcgttcggcgcatcgggctgag
aacggcgccgtcggctgggacgacccgcgtgagtcgggtgaggtgccggacatctacctg
gcgatggggcagacggccgagaacctggcgctggcgcgcggggtgacccgcgccgagatg
gacgccttcggggtgcgttcgcagaacctcgccgagaaggccatcgcggacggcttctgg
gccgaggagatcaccccggtgacgctgcccgacggcaccgtcgtcgccaccgatgacggg
ccgcgcgcgggcgtgacgctggaggccgtgtcgggtctgaagccggtgttccggccggac
ggccgggtcacggcgggcaactgctgtccgctcaacgacggcgctgccgcggtgatcgtc
atgagcgacaccaaggccgccgagctggggatcacgccgctggcccggatcgtgtcgacc
ggggtcaccgcgatgtcgccggagatcatgggcatcggcccggtcgaggcgtcgtggcag
gcgctggcccgggcggggttgggcatcgacgacatggacctggtggagatcaacgaggcc
ttcgccgcgcaggtgatcccgtcgtaccaggacctcggggtgccgctggagaagctcaac
gtccacggtggagccatcgcggtggggcacccgttcggcatgaccggcgcccgcatcacc
ggcacgctgctgcacggtttgcagcgcaccggtggccgatacgggctggagacgatgtgc
gtcggcggcggccagggcatggcgatggtcatcgaacggctgtga

KEGG   Stackebrandtia nassauensis: Snas_3019Help
Entry
Snas_3019         CDS       T01194                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sna  Stackebrandtia nassauensis
Pathway
sna00071  Fatty acid degradation
sna00072  Synthesis and degradation of ketone bodies
sna00280  Valine, leucine and isoleucine degradation
sna00310  Lysine degradation
sna00362  Benzoate degradation
sna00380  Tryptophan metabolism
sna00620  Pyruvate metabolism
sna00630  Glyoxylate and dicarboxylate metabolism
sna00640  Propanoate metabolism
sna00650  Butanoate metabolism
sna00900  Terpenoid backbone biosynthesis
sna01100  Metabolic pathways
sna01110  Biosynthesis of secondary metabolites
sna01120  Microbial metabolism in diverse environments
sna01130  Biosynthesis of antibiotics
sna01200  Carbon metabolism
sna01212  Fatty acid metabolism
sna02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Snas_3019
   00630 Glyoxylate and dicarboxylate metabolism
    Snas_3019
   00640 Propanoate metabolism
    Snas_3019
   00650 Butanoate metabolism
    Snas_3019
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Snas_3019
   00072 Synthesis and degradation of ketone bodies
    Snas_3019
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Snas_3019
   00310 Lysine degradation
    Snas_3019
   00380 Tryptophan metabolism
    Snas_3019
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Snas_3019
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Snas_3019
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Snas_3019
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sna04147]
    Snas_3019
Enzymes [BR:sna01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Snas_3019
Exosome [BR:sna04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Snas_3019
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ADD42690
UniProt: D3QAA7
LinkDB All DBs
Position
3183889..3185193
Genome map
AA seq 434 aa AA seqDB search
MATQKSRSKPRTVTPVAILGGNRIPFAKSNGAYAHASNADMLTSALDGLVARFGLAGARL
DEVVAGAVLKHSRDFNLTRECVLGSRLSPQTPAFDVQRACGTSLEATIAVANKIALGQID
SGVAGGVDTTSDAPLAVHEDLRQLLLDANRARSFGGRVKAFARMRPWHAMPEIPRNAEPR
TGLSMGEHAARTALHWDISRADQDALAVNSHQRLAAAYDRGFFDDLVTGYLGLTRDGLLR
ADTSVEKLAKLAPAFGSGEQATMTAGNSSPLTDGAATVLLSSPEWASEHSLPVLAHLVDC
QSAAVDFVSGDEGLLTAPVYAVPKLLRRNGLSLSDFDFYEIHEAFASQVLATLAAWRDPE
FCAERLGLDEPLGEIDDKRLNVAGSSLATGHPFAATGARIVATAAKLLAEKGSGRALISI
CAAGGQGVTAILER
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgcagaaatcccgctccaagccccgcaccgtcacaccggtggcgatcctgggc
ggcaacaggatcccgttcgccaagtccaacggcgcctacgcgcacgcgtccaacgccgac
atgctgaccagcgccctggacggactggtggcccggttcgggctggccggggcccggctg
gacgaggtggtcgccggggcggtcctgaagcacagccgcgacttcaacctgacccgcgaa
tgcgtactcggttcccgactgtcaccccagacccccgccttcgacgtgcagcgcgcctgc
ggcaccagcctggaggccaccatcgcggtggccaacaagatcgcgctgggccagatcgac
agcggcgtggccgggggagtggacaccaccagcgacgccccgctggccgtccacgaggac
ctgcggcagctgctgctggacgccaaccgcgccaggagcttcggcggccgggtcaaggcc
ttcgcccggatgcgtccctggcacgcgatgcccgagatcccgcgcaacgccgaaccccgc
accggactgtccatgggggagcacgccgcccgcaccgcgctgcactgggacatctcccgc
gccgaccaggacgcgctggccgtcaacagccaccagcgcctggccgccgcctacgaccgg
ggcttcttcgacgacctggtcaccggctacctgggactgacccgcgacggcctgctgcgc
gccgacacctcggtggagaaactcgcgaaactggccccggccttcggatcgggggagcag
gccaccatgacggcgggcaactcctcgccgctgaccgacggcgcggccacggtgctgctg
tccagccccgaatgggcaagcgaacactcgctgccggtgctggcccacctggtcgactgc
cagtccgcggccgtcgacttcgtgtccggggacgagggactgctgaccgccccggtgtac
gcggtgccgaaactgctgcgccgcaacggactgagcctgtccgatttcgacttctacgag
atccacgaggccttcgcctcacaggtgctggccacgctggccgcgtggcgggacccggag
ttctgcgccgaacgcctgggcctggacgagccgctgggcgagatcgacgacaagcgcctc
aacgtcgccggatcctcgctggccaccggccaccccttcgccgccaccggagcccggatc
gtggccacggccgcgaaactcctggccgagaagggttccggccgcgcgctgatctcgatc
tgcgccgccggaggacaaggagtaacggcgatcctggagcgctga

KEGG   Stackebrandtia nassauensis: Snas_3891Help
Entry
Snas_3891         CDS       T01194                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sna  Stackebrandtia nassauensis
Pathway
sna00071  Fatty acid degradation
sna00072  Synthesis and degradation of ketone bodies
sna00280  Valine, leucine and isoleucine degradation
sna00310  Lysine degradation
sna00362  Benzoate degradation
sna00380  Tryptophan metabolism
sna00620  Pyruvate metabolism
sna00630  Glyoxylate and dicarboxylate metabolism
sna00640  Propanoate metabolism
sna00650  Butanoate metabolism
sna00900  Terpenoid backbone biosynthesis
sna01100  Metabolic pathways
sna01110  Biosynthesis of secondary metabolites
sna01120  Microbial metabolism in diverse environments
sna01130  Biosynthesis of antibiotics
sna01200  Carbon metabolism
sna01212  Fatty acid metabolism
sna02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Snas_3891
   00630 Glyoxylate and dicarboxylate metabolism
    Snas_3891
   00640 Propanoate metabolism
    Snas_3891
   00650 Butanoate metabolism
    Snas_3891
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Snas_3891
   00072 Synthesis and degradation of ketone bodies
    Snas_3891
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Snas_3891
   00310 Lysine degradation
    Snas_3891
   00380 Tryptophan metabolism
    Snas_3891
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Snas_3891
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Snas_3891
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Snas_3891
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sna04147]
    Snas_3891
Enzymes [BR:sna01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Snas_3891
Exosome [BR:sna04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Snas_3891
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ADD43546
UniProt: D3PYW3
LinkDB All DBs
Position
complement(4158808..4160010)
Genome map
AA seq 400 aa AA seqDB search
MAEAFIYDWVRTPRGKGKGGSLHSVKPVSLASGLLDALRERGGFDTTRVDDVVLGCVTPI
NEQGGDIARAAVLMSGWDRETSGVQVNRFCASGLEAVNLAAAKVASGFEDVAVAGGVESM
SRNKMASDGGAWFLDPETNLRTGFVPQGISADLIATREGYSREDVDAVAVASHAKAAAAW
QDKRFARSVVPVVDVNGQTLLDTDETIRPGTSLETLAGLKPSFADVGAFGFDSVAINRYP
EVEYIRHVHHAGNSSGIVDGAAAMLIASERGGQALGLRPRARIRAAAVTGTEPTIMLTGP
APAARKALARAGMAATDIDLYEMNEAFASAVLKFQRELDVDDDILNVNGGAIAMGHPLGA
TGCMILGTLVDELERRDLNTGLATLCVGGGMGIATIVERV
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggcagaggcgttcatctacgactgggtgcgcacaccccggggcaagggcaagggtggg
tcgctgcacagcgtcaaacccgtgtcgctggcgtcggggctgttggacgcgctgcgcgag
cggggcggattcgacaccacccgcgtcgacgacgtcgtgctgggctgcgtcacccccatc
aacgagcagggcggcgacatcgcccgcgccgcggtgctgatgtccggctgggaccgtgag
acctccggggtccaggtcaaccggttctgcgcctccggcctggaggcggtgaacctggcc
gcggccaaggtcgcctccggcttcgaggacgtcgcggtggccggtggcgtggaatccatg
tcccgcaacaagatggcctccgacggcggcgcctggttcctcgaccccgagacgaacctg
cgcaccgggttcgtcccgcagggcatctccgccgacctcatcgccacccgcgagggctac
tcccgtgaggacgtcgacgccgtcgccgtcgcctcgcacgccaaggccgccgcggcctgg
caggacaagcgcttcgcccgttcggtggtcccggtcgtcgacgtcaacggacagaccctg
ctggacaccgacgagaccatccggcccggcaccagcctggagacgctggccggactcaaa
ccgtccttcgccgacgtgggcgccttcggattcgactccgtggcgatcaaccgttacccc
gaggtggagtacatccggcacgtgcaccacgccggcaactcttccggcatagtggacggt
gccgccgcgatgctgatcgccagcgaacgcggcggccaagccctgggactgcggccccgg
gcccggatccgggcggcggccgtgaccggcaccgaaccgaccatcatgctcaccggcccg
gccccggccgcccgcaaggcactggcccgggcgggcatggcggccaccgacatcgacctg
tacgagatgaacgaggccttcgcctcggcggtgctgaagttccagcgcgaactcgacgtc
gacgacgacatcctcaacgtcaacggcggcgccatcgccatgggacatcccttgggcgcc
accggctgcatgatcctggggacgctggtggacgaactggaacgccgtgacctcaacacg
ggactggccacgctgtgcgtcggcggcggcatgggaatcgcgacgatcgtcgaaagggtg
taa

KEGG   Stackebrandtia nassauensis: Snas_5999Help
Entry
Snas_5999         CDS       T01194                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sna  Stackebrandtia nassauensis
Pathway
sna00071  Fatty acid degradation
sna00072  Synthesis and degradation of ketone bodies
sna00280  Valine, leucine and isoleucine degradation
sna00310  Lysine degradation
sna00362  Benzoate degradation
sna00380  Tryptophan metabolism
sna00620  Pyruvate metabolism
sna00630  Glyoxylate and dicarboxylate metabolism
sna00640  Propanoate metabolism
sna00650  Butanoate metabolism
sna00900  Terpenoid backbone biosynthesis
sna01100  Metabolic pathways
sna01110  Biosynthesis of secondary metabolites
sna01120  Microbial metabolism in diverse environments
sna01130  Biosynthesis of antibiotics
sna01200  Carbon metabolism
sna01212  Fatty acid metabolism
sna02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Snas_5999
   00630 Glyoxylate and dicarboxylate metabolism
    Snas_5999
   00640 Propanoate metabolism
    Snas_5999
   00650 Butanoate metabolism
    Snas_5999
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Snas_5999
   00072 Synthesis and degradation of ketone bodies
    Snas_5999
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Snas_5999
   00310 Lysine degradation
    Snas_5999
   00380 Tryptophan metabolism
    Snas_5999
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Snas_5999
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Snas_5999
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Snas_5999
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sna04147]
    Snas_5999
Enzymes [BR:sna01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Snas_5999
Exosome [BR:sna04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Snas_5999
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ADD45625
UniProt: D3Q096
LinkDB All DBs
Position
complement(6351831..6353027)
Genome map
AA seq 398 aa AA seqDB search
MTGDDRTTSVLVAGARTPNGKLLGGLGDIPATKLGSHAIAAALTRAGVDAGQVEYVILGQ
VLQAGAGQNPARQAAAGAGIPLTIPSLNVNKVCLSGLTAIAMADQLIRAGEIEIAVAGGM
ESMTLAPHLLTGQRKGYKYGDVTMADHMALDGLTDAYEHIPMGESTENHNTKLGIGRAEQ
DEFAAASHVRAAAAQKNGRFDREIAAFEVPQRKGDPIVVSADEGVRADTTPEVLARLRPS
FTKDGTITAGNSSPISDGAAAVVVMSKAKANELGLEYLAEIGAHGMVAGPDTSLHSQPSR
AIQAALAKSGKSTSDLSVIEINEAFAAVGIQSTRDLGVDPQIVNPNGGAIALGHPIGASG
ARLALTLAHELRERGGGLGAAALCGGGGQGDALLLRVS
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgacaggcgacgatcgcaccacgagtgttcttgtcgcgggcgcccgcaccccgaacggc
aaactgctcggcgggctgggggacatcccggccaccaagctcggatcccacgccatcgcc
gccgcgctgacgcgcgccggggtggacgccgggcaggtggagtacgtgatcctggggcag
gtcctgcaggccggcgccggtcagaacccggctcgccaggccgccgccggtgccggaatt
ccgctgacgatcccgtcgctgaacgtcaacaaggtgtgcctgtccgggctgaccgcgatc
gcgatggccgaccagctgatccgggccggtgagatcgagatcgccgtcgccgggggcatg
gagtcgatgacgctggcgccgcacctgctcaccgggcagcgcaagggatacaagtacggc
gacgtgacgatggccgaccacatggccctggacggcctgaccgacgcctacgagcacatc
ccgatgggggagtcgaccgagaaccacaacacgaagctggggatcgggcgggccgagcag
gacgagttcgccgccgcctcgcacgtgcgcgccgccgcggcgcagaagaacggccgcttc
gatcgtgagatcgcggccttcgaggtgccgcagcgcaagggcgacccgatcgtggtctcc
gccgacgagggcgtgcgggccgacaccacccccgaggtgctggcgcggctgcggccgtcg
ttcaccaaggacggcaccatcacggcgggcaactcctcgccgatctcggacggggccgcc
gccgtcgtcgtcatgagcaaggcgaaggcgaacgagctggggcttgagtacctggccgag
atcggggcgcacggcatggtcgccggtcccgacacctcgctgcactcgcagccgtcccgg
gcgatccaggccgcgctggccaagtccggcaagtctacttcggacctctcggtcatcgag
atcaacgaggccttcgccgcggtggggatccagtccacccgggacctgggcgtcgacccg
cagatcgtcaaccccaacgggggcgccatcgctctggggcacccgatcggggcctccgga
gcccggctggcgctgaccctcgcccacgagctgcgcgagcgcggcggcgggctcggtgcc
gcggccctgtgcggcggcggtggacagggcgacgcactgctgctgagggtgtcttga

DBGET integrated database retrieval system