KEGG   Stackebrandtia nassauensis: Snas_1222Help
Entry
Snas_1222         CDS       T01194                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
sna  Stackebrandtia nassauensis
Pathway
sna00020  Citrate cycle (TCA cycle)
sna00480  Glutathione metabolism
sna01100  Metabolic pathways
sna01110  Biosynthesis of secondary metabolites
sna01120  Microbial metabolism in diverse environments
sna01130  Biosynthesis of antibiotics
sna01200  Carbon metabolism
sna01210  2-Oxocarboxylic acid metabolism
sna01230  Biosynthesis of amino acids
Module
sna_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sna_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:sna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Snas_1222
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Snas_1222
Enzymes [BR:sna01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     Snas_1222
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh NTP_transf_6
Motif
Other DBs
NCBI-ProteinID: ADD40932
UniProt: D3QBB5
LinkDB All DBs
Position
1295102..1296319
Genome map
AA seq 405 aa AA seqDB search
MAKIKVENPVVELDGDEMTRIIWQQIKDKLIHPYLDVDLKYFDLSVQKRDETDDQITVDA
ANAIKEHSVGVKCATITPDEARVEEFGLKKMWRSPNGTIRNILGGVVFREPIIMSNVPRL
VPGWTKPIIIGRHAHGDQYKATDFKVPGPGTLTVTFQPADGSEPMEFEVAQYPEGGGVAM
AMYNYRKSIEDFARASFRYGLARDYPVYMSTKNTILKAYDGMFKDVFQEIFDNEFKTEFD
AKGLTYEHRLIDDMVAAAMKWEGGYVWACKNYDGDVQSDTVAQGFGSLGLMTSVLMTPDG
KTVEAEAAHGTVTRHYRQYQQGKATSTNPIASIFAWTRGLAHRGKIDNTPAVTDFAEKLE
QVCVETVESGQMTKDLALLVGGDAKFLTTDEFMNALDENLRKKIG
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggccaaaatcaaggtagagaaccccgtcgtcgagctcgacggcgacgagatgacccgg
atcatctggcagcagatcaaggacaagttgatccacccgtatctcgacgtcgacctgaag
tacttcgacctgtcggtgcagaagcgcgacgagaccgacgaccagatcacggtggacgcc
gccaacgcgatcaaggagcactcggtcggcgtcaagtgcgccaccatcacccccgacgag
gcgcgggtcgaggagttcggcctcaagaagatgtggcgctcgcccaacgggacgatccgc
aacatcctcggcggcgtggtgttccgcgagcccatcatcatgagcaacgtgccgcggctc
gtccccggctggaccaagccgatcatcatcggccgtcacgcgcacggcgaccagtacaag
gccaccgacttcaaggtccccggccccggcacgctgaccgtgaccttccagcccgccgac
ggctccgagccgatggagttcgaggtcgcgcagtaccccgagggcggcggcgtggccatg
gccatgtacaactaccgcaagtccattgaggacttcgcgcgcgcgtccttccgctacggc
ctggcccgcgactacccggtctacatgtccaccaagaacaccatcctcaaggcctacgac
ggcatgttcaaggacgtgttccaggagatcttcgacaacgagttcaagaccgagttcgac
gccaagggcctgacctacgagcaccggctcatcgacgacatggtcgccgccgccatgaag
tgggagggcggctacgtctgggcctgcaagaactacgacggtgacgtgcagtccgacacc
gtggcgcagggcttcggctcgctgggcctgatgacctcggtactgatgacccccgacggc
aagaccgtcgaggccgaggccgcgcacggcaccgtgacccggcactaccgccagtaccag
cagggcaaggccacctcgaccaacccgatcgcgtccatcttcgcgtggacccggggcctg
gcccaccggggcaagatcgacaacacccccgcggtcaccgacttcgccgagaagctggag
caggtctgcgtcgagaccgtcgagagcggacagatgaccaaggacctggcgctcctggtc
ggcggcgacgccaagttcctgaccaccgacgagttcatgaacgcgctggacgagaacctg
cgcaagaagatcggctga

DBGET integrated database retrieval system