KEGG   Stackebrandtia nassauensis: Snas_2145Help
Entry
Snas_2145         CDS       T01194                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
Organism
sna  Stackebrandtia nassauensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 NYN
Motif
Other DBs
NCBI-ProteinID: ADD41839
UniProt: D3Q1X2
LinkDB All DBs
Position
2275065..2276105
Genome map
AA seq 346 aa AA seqDB search
MKVVRFHAPGNVAIEDAPAPSPGPGEVLLRVGACSTCGTDVKISRFGHHHIVPPRVMGHE
IAGEIAELGDGVADWAVGDRVQVIAAIPCGQCEICKAGRMTVCPNQESMGYHYDGGFASH
VVVPAKVLAVDGLNRIPEELSFAEASVAEPLACVLNGQELARVGVGDDVLVIGSGPIGCL
HVRLARARGASRVFLADLSRKRLDLAAGIVSPDATICSGDTDLVEAVAELTGGRGIDVAI
VAAASGAAQEQALLTAARGGRVSLFGGLPKDNPVISLDANLVHYRELTVVGANGSSPAHN
AEALRLIASGAVNVADLITHRLPLDRAIEAFDIVAGGEAIKVTIEP
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtggttcggttccacgcgcccggcaatgtggccattgaggatgccccggcgccc
tcgcccggccccggcgaggtactgcttcgggtcggcgcctgctccacctgcggcaccgac
gtcaagatctcccggttcgggcaccaccacatcgtcccgccccgcgtcatggggcacgag
atcgccggtgagatcgccgaactcggcgacggcgtcgccgactgggcggtcggcgaccgg
gtccaggtcatcgccgcgatcccgtgtggacagtgcgagatctgcaaggcgggccggatg
acggtgtgccccaaccaggagtccatgggataccactacgacggcggcttcgccagccac
gtggtggtaccggccaaggtgctcgccgtcgacggcctcaaccggatcccggaggagctg
agcttcgccgaggcgtcggtggccgaaccgctcgcgtgtgtcctcaacggacaggaactg
gcgcgggtgggtgtcggcgacgatgtcctggtcatcggctccggcccgatcggttgcctg
cacgtccggctggcccgggcgcgcggcgcgtcgcgggtgttcctggccgacctgagccgc
aaacggctcgacctggccgccgggatcgtctccccggacgccaccatctgcagcggcgac
accgacctggtcgaggccgtcgccgaactgaccggcggacgcggcatcgacgtcgccatc
gtcgccgccgcctcgggtgccgcccaggaacaggcgctgctgaccgcggcccgcggcggc
cgggtgagcctgttcggcggcctgcccaaggacaacccggtcatctcgctggacgccaac
ctggtccactaccgcgagctgacggtcgtgggcgccaacggatcctccccggcgcacaac
gcggaagccctgcggctcatcgcctcgggcgccgtcaacgtcgccgacctgatcacccac
cggctgccactggaccgcgcgatcgaagccttcgacatcgtcgcaggtggagaagccatc
aaggtcaccatcgaaccctag

DBGET integrated database retrieval system