KEGG   Stackebrandtia nassauensis: Snas_2815Help
Entry
Snas_2815         CDS       T01194                                 

Definition
(GenBank) DNA polymerase LigD, polymerase domain protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
sna  Stackebrandtia nassauensis
Pathway
sna03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:sna00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    Snas_2815
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sna03400]
    Snas_2815
Enzymes [BR:sna01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Snas_2815
DNA repair and recombination proteins [BR:sna03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Snas_2815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADD42491
UniProt: D3Q8B7
LinkDB All DBs
Position
2961218..2962135
Genome map
AA seq 305 aa AA seqDB search
MAPVSQRVRFGDRELTVSHLDKLMYPETGTTKADVIDYYARAAAVLLPHITGRILTRVRY
PHGTGDVRFFEKHAPPAVPPWLRTATVPSKTHADGVTYVVADEPAALVWLANLYTIELHT
PQWQLDDTAPDSTRRPDRLVIDLDPGEGAGITECVHIAHLVRERLEADGLIAYPKTSGKN
GVHLVVPISGTQPAEQVIDYAKALARSLAAAHPRLVTATMGPRNRIGKVLIDWSQNNPAK
TTVAAYSLRGQPRPVISTPITWSELDAGNTGPFGPEAVLGRVATLGDLHADVTTPGPPLP
VAAGR
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggcaccggtttcgcagcgggtccgcttcggcgaccgggagctgaccgtgtcgcacctc
gacaaattgatgtaccccgagaccggcaccaccaaggccgacgtaatcgattactacgcg
cgcgccgccgccgtcctgctgccccacatcaccggccgcatcctcacccgggtgcggtac
ccgcacggcaccggcgacgtccggtttttcgagaagcatgccccgcccgccgtccccccg
tggttgcgcaccgccaccgtccccagcaagacccacgccgatggcgtcacctacgtcgtc
gccgacgaacccgccgcgctcgtgtggctggcgaacctgtacaccatcgagcttcacact
ccacaatggcagctcgacgacaccgccccggacagcacccgccgtcccgaccggctcgtc
atcgacctcgaccccggcgagggcgccggaatcaccgagtgcgtccacatcgctcacctg
gtgcgggagcggctcgaagccgacggcctgatcgcctaccccaagacctcgggcaagaac
ggcgtgcacctggtggtgcccatcagcggcacccaaccggccgagcaggtcatcgattac
gccaaggctctcgcccgtagcctggccgcagcccatccccgtctcgtcaccgccaccatg
gggccgcgcaaccggatcggcaaggtcctcatcgactggagccagaacaatccggccaag
acgaccgtcgccgcgtactcgctgcgtggccagccccgtccggtgatttcgacccccatc
acatggtccgaactggacgccgggaacaccggccccttcggccccgaagcggtgctggga
cgggttgccaccctgggcgacctgcacgccgacgtcaccacgcccgggccgccgctgccc
gtcgccgctgggcggtga

DBGET integrated database retrieval system