KEGG   Stackebrandtia nassauensis: Snas_3033Help
Entry
Snas_3033         CDS       T01194                                 

Definition
(GenBank) aconitate hydratase 1
  KO
K01681  aconitate hydratase [EC:4.2.1.3]
Organism
sna  Stackebrandtia nassauensis
Pathway
sna00020  Citrate cycle (TCA cycle)
sna00630  Glyoxylate and dicarboxylate metabolism
sna01100  Metabolic pathways
sna01110  Biosynthesis of secondary metabolites
sna01120  Microbial metabolism in diverse environments
sna01200  Carbon metabolism
sna01210  2-Oxocarboxylic acid metabolism
sna01230  Biosynthesis of amino acids
Module
sna_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sna_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
sna_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Snas_3033
   00630 Glyoxylate and dicarboxylate metabolism
    Snas_3033
Enzymes [BR:sna01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.3  aconitate hydratase
     Snas_3033
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase Aconitase_C
Motif
Other DBs
NCBI-ProteinID: ADD42704
UniProt: D3QAC1
LinkDB All DBs
Position
complement(3198635..3201379)
Genome map
AA seq 914 aa AA seqDB search
MPSIDTFAARAELRVGDTEHTYYRIDAVSGHDRLPYSLKILLENLLRTEDGANITEGHIR
ALGSWDPKAAPSVEIQFTPARVIMQDFTGVPCVVDLATMREAVRDLGGDPAAINPLAPAE
LVIDHSVMVDFFGHPDSFERNVEREYQRNKERYQFLRWGQTAFDEFKVVPPGTGIVHQVN
IEHLARVVMDRDGVVYPDTCVGTDSHTTMENGLGVLGWGVGGIEAEAAMLGQPISMLIPR
VVGFKLTGELPAGATATDLVLTVTEQLRAHGVVGKFVEFYGEGVGSVPLADRATLGNMSP
EFGSTCAIFPIDDETLAYLRLTGRSDEQVALVEAYAKAQGMWHDPSKEAEYSEYLELDLA
TVVPSIAGPKRPQDRIAITAAKDTWRSNVRDYVSNGDDDEAGKESFPASDAPAESPGDGR
PHHPMSVVLDDGTATEIDHGAVVIAAITSCTNTSNPYVMVGAALLAKNAVDKGLSRKPWV
KTSLAPGSQVVTGYLERAGLSPYLDKLGFNLVGYGCTTCIGNSGPLPEAISKAVADGDLA
VTSVLSGNRNFEGRINPDVKMNYLASPPLVVAYALAGSMDFDLNNEPLGNDADGKPIMLA
DIWPSAEEIATVVNSSIGREMFTADYANVFDGDERWKALPIPTGNTFEWDTDSTYVRKAP
YFEGMPASPEAVGDITGARVLAKLGDSVTTDHISPAGAIKADSPAGKYLKDNGVGPADFN
SYGSRRGNHEVMIRGTFANIRLRNQLAPGTEGGFTRDFTADEAPVTTIYDAAQNYASAGT
PLVVLAGKEYGSGSSRDWAAKGTRLLGVRAVIAESYERIHRSNLIGMGVLPLQFPEGQSA
DKLRLTGEESFAISGITALNDGPVPGTVRVTATSPAGEQVADFEAVVRIDTPGEAEYYRH
GGILQYVLRSLLAK
NT seq 2745 nt NT seq  +upstreamnt  +downstreamnt
gtgccgagcattgacaccttcgccgcgcgcgccgaacttcgcgtcggcgacaccgagcac
acctactaccgcatcgacgccgtgagcgggcacgatcggttgccgtacagcctgaagatc
ctgctggagaacctgctgcgcaccgaggacggcgccaacatcaccgagggtcacatccgg
gcgctgggctcgtgggacccgaaggcggcgcccagtgtggagatccagttcacgcccgcc
cgcgtcatcatgcaggacttcaccggcgtcccctgtgtcgtcgacctggcgaccatgcgc
gaggccgtccgcgacctgggcggcgacccggccgcgatcaacccgctggcgcccgccgag
ctggtcatcgaccactccgtcatggtcgacttcttcggccaccccgactccttcgagcgc
aatgtggagcgtgagtaccagcgcaacaaggagcggtaccagttcctgcgctggggccag
accgcctttgacgagttcaaggtggtgccgccgggcaccggcatcgtccaccaggtgaac
atcgagcacctggcccgcgtcgtcatggaccgcgacggcgtggtctaccccgacacctgc
gtcggcaccgactcgcacaccaccatggagaacggcctgggcgtgctgggctggggcgtg
ggcggtatcgaggccgaggcggccatgctgggccagccgatctcgatgctgatcccccgc
gtcgtcggcttcaagctgaccggcgagctgcccgcgggcgccaccgccaccgacctggtg
ctgaccgtcaccgagcagctgcgcgcccacggcgtggtcggcaagttcgtggagttctac
ggcgagggcgtcggttcggtgccgctggccgaccgggcgacgctgggcaacatgagcccc
gagttcggctccacctgcgccatcttccccatcgacgacgagacgctggcctacctgcgg
ctgaccggccgcagcgacgagcaggtcgcgctggtcgaggcctacgccaaggcgcagggc
atgtggcacgatccgtccaaagaggccgagtacagcgagtacctggagctggacctggcc
accgtggtgccctcgatcgccgggccgaagcgcccgcaggaccgcatcgccatcaccgcc
gccaaggacacctggcgctccaacgtgcgcgactacgtcagcaacggtgacgacgacgag
gcgggcaaggagagcttcccggcctccgacgcccccgccgagtcgcccggcgacggccgt
ccgcaccacccgatgtcggtggtgctcgacgacggcaccgccaccgagatcgaccacggc
gcggtggtcatcgcggccatcacctcgtgcaccaacacctccaacccgtacgtgatggtg
ggcgcggcgctgctggccaagaacgccgtcgacaagggactgtcgcgcaagccgtgggtg
aagacctcgctggcaccgggatcgcaggtcgtgaccggttacctggagcgggccggactg
agcccgtacctggacaagctgggcttcaacctggtcggctacggctgcaccacatgcatc
ggcaactccggcccgctgccggaggccatctccaaggctgtggccgacggcgacctggcg
gtgacctcggtgctgtcgggcaaccgcaacttcgagggccgcatcaacccggacgtgaag
atgaactacctggcctcgccgccgctggtggtcgcctacgcgctggccggttcgatggac
ttcgacctcaacaacgagccgctggggaacgacgccgacggcaagccgatcatgctggcc
gacatctggccctcggccgaggagatcgccacggtcgtcaactcctcgatcgggcgcgag
atgttcaccgccgactacgccaacgtcttcgacggcgacgagcgctggaaggcgctgccg
atcccgaccggcaacaccttcgagtgggacaccgactcgacctacgtgcgcaaggcgccg
tacttcgaggggatgcccgcgagccccgaggcggtcggcgacatcaccggcgcccgggtg
ctggcgaagctgggcgactcggtcaccaccgaccacatctcccccgccggtgccatcaag
gccgattccccggccggcaagtacctgaaggacaacggggtcggcccggccgacttcaac
tcctacggttcccggcgcggcaaccacgaggtgatgatccgcggcaccttcgccaacatc
cggctgcgcaaccagctggcgccgggcaccgagggcggcttcacccgcgacttcaccgcc
gacgaggctccggtgacgacgatctacgacgccgcgcagaactacgcctcggccgggaca
ccgctggtcgttctggcgggcaaggaatacggctccggttcctcaagggactgggcggcc
aagggcacccggctgctgggggttcgggccgtcatcgccgagtcctatgagcgcattcac
cggtcgaacctgatcggcatgggcgtgctgccgttgcagttcccggagggacagtcggcc
gacaagctgcggctgaccggtgaggagagcttcgcgatctccggcatcaccgcgctcaac
gacggtccggtgccgggcaccgtgcgggtcacggcgaccagcccggccggtgagcaggtg
gccgacttcgaggccgtggtgcgcatcgacacccctggtgaggcggagtactaccggcac
ggcggcatcctgcagtacgtgctgcgctcgctgctcgccaaatag

DBGET integrated database retrieval system