KEGG   Stackebrandtia nassauensis: Snas_3466Help
Entry
Snas_3466         CDS       T01194                                 

Definition
(GenBank) pyruvate dehydrogenase (acetyl-transferring) E1 component, alpha subunit
  KO
K00161  pyruvate dehydrogenase E1 component alpha subunit [EC:1.2.4.1]
Organism
sna  Stackebrandtia nassauensis
Pathway
sna00010  Glycolysis / Gluconeogenesis
sna00020  Citrate cycle (TCA cycle)
sna00620  Pyruvate metabolism
sna01100  Metabolic pathways
sna01110  Biosynthesis of secondary metabolites
sna01120  Microbial metabolism in diverse environments
sna01200  Carbon metabolism
Module
sna_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Snas_3466
   00020 Citrate cycle (TCA cycle)
    Snas_3466
   00620 Pyruvate metabolism
    Snas_3466
Enzymes [BR:sna01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     Snas_3466
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1_dh TPP_enzyme_C Transketolase_N DXP_synthase_N 3-alpha
Motif
Other DBs
NCBI-ProteinID: ADD43130
UniProt: D3PVL6
LinkDB All DBs
Position
3666867..3667847
Genome map
AA seq 326 aa AA seqDB search
MTAHPEVDAGHRRELLHQMLRIRRFEERCAELYSATKIRGFVHLCIGEEAVAVGVHKALA
DDDAVVSTYREHGHALAKGITMDAVMAEMYGKATGCSHGRGGSMHLFDRDARFYGGNAIV
GGGLPLAVGLALADTRLGRRQVTACFFGDGAVAEGEFHESLNLAALWRLPVLFCCENNQY
AMGTPLRREHANTDLGARAVGYGMRSMEVDGMDVLAVEAAAHEAVAHIGRHREPVFLELR
TYRFRAHSMYDPDRYRDKTEIESWKRRDPIPALAASLRATADLSDSDMDKMESEVTAEID
GAVAAAEAAPVEPESELTRHVYTERA
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
gtgactgcccatcccgaagtcgacgccggacatcgccgggaactgttgcaccagatgctg
cgcatccgccggttcgaggaacgctgcgccgaactgtacagcgccaccaagatccggggc
ttcgtgcacctgtgcatcggcgaggaggcggtcgccgtcggagtacacaaggcactcgcc
gacgatgacgcggtggtgtccacgtaccgcgaacacggccacgcgctggccaaaggcatc
accatggacgccgtcatggccgagatgtacggcaaggccaccggttgcagtcacggacgg
ggcggctccatgcacctgttcgaccgtgacgcccgcttctacggcggcaacgccatcgtc
ggcggaggtctgccgctcgcggtgggtctggcgctggccgacacccggctgggacgccgc
caggtgaccgcgtgtttcttcggcgacggggccgtcgccgagggcgaattccacgaaagc
ctcaacctcgccgcgctgtggcggctgccggtgttgttctgctgcgagaacaaccagtac
gccatggggaccccgttgcgccgggagcacgccaacaccgatctgggagcccgcgccgtc
ggttacggcatgcggtcgatggaggtggacggcatggacgtcctggccgtggaggccgcc
gcccacgaagcggtggcccacatcggcagacatcgggaaccggtgttcctggaactgcgc
acctaccggttccgggcgcactcgatgtacgaccccgaccggtaccgggacaagacggag
atcgagtcctggaagcggcgcgatccgatcccggctctggccgcgtcgttgcgagccacg
gcggacctcagcgactccgatatggacaagatggagtccgaggtcaccgccgagatcgac
ggtgccgtggccgccgcggaggcggcaccagtggagccggagtccgaactgacccggcac
gtctacacggagcgtgcgtga

KEGG   Stackebrandtia nassauensis: Snas_3467Help
Entry
Snas_3467         CDS       T01194                                 

Definition
(GenBank) Transketolase central region
  KO
K00162  pyruvate dehydrogenase E1 component beta subunit [EC:1.2.4.1]
Organism
sna  Stackebrandtia nassauensis
Pathway
sna00010  Glycolysis / Gluconeogenesis
sna00020  Citrate cycle (TCA cycle)
sna00620  Pyruvate metabolism
sna01100  Metabolic pathways
sna01110  Biosynthesis of secondary metabolites
sna01120  Microbial metabolism in diverse environments
sna01200  Carbon metabolism
Module
sna_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Snas_3467
   00020 Citrate cycle (TCA cycle)
    Snas_3467
   00620 Pyruvate metabolism
    Snas_3467
Enzymes [BR:sna01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     Snas_3467
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr Transketolase_C PFOR_II
Motif
Other DBs
NCBI-ProteinID: ADD43131
UniProt: D3PVL7
LinkDB All DBs
Position
3667847..3668854
Genome map
AA seq 335 aa AA seqDB search
MTGTEPATTEARTVTLTYREAMRDALRRALADEPVFLIGEDVGQYGGAFGVTLGLLEEFG
PERVIDTPLSESGFVGAGIGAALGGTLPIVEVMTVNFSLLALDQILNNAATLSHMSGGRL
HVPLVIRMTTGAGRQLAAQHSHSLEGWYAHIPGLRILAPATVEDARGMLAPALADPDPVL
IFEHGSLYNDKATLPATPVPVSIDTAAIRRPGTDATVIGYGGTLATALSAADQLATEGIQ
AEVIDLRSLRPLDDATIMESVSRTHRAVIVDEGWRSGSLAAEISARITEQAFYDLDAPVE
RVCSAEVPMPYARHLEQAALPRPSDVAASVRRTVN
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgaccggaaccgaacccgccaccaccgaagcgcggaccgtcaccctcacctatcgcgaa
gccatgcgcgacgcgctgcgccgggcactggccgacgaaccggtcttcctgataggtgag
gacgtcggccagtacggcggcgccttcggcgtcaccctgggactcctggaggaattcggc
cccgagcgcgtcatcgacaccccgctgtccgaatccggcttcgtcggggccggcatcggt
gccgcactgggcggaacactgccgatcgtcgaggtcatgacggtcaatttcagcctgctg
gctttggaccagatcctcaacaacgccgcaacactgtcgcatatgtccggtggtcgactc
catgtgccgctggtgatccgcatgaccaccggcgccggacgacagctggcggcccaacac
tcgcacagcctggagggctggtacgcccacataccgggcctgcgcatcctggcaccagcc
actgtggaagacgccagggggatgctcgcgcccgccctggccgaccccgacccggtgctg
atcttcgaacacggctcgctgtacaacgacaaggcgaccctgcccgcgacaccggtgccg
gtctccatcgacaccgccgcgatccggcgccccgggaccgatgccaccgtcatcggctac
ggcggaacgctcgcgacggccctgtccgccgcggaccagctggcgacggagggcatccag
gccgaggtcatcgacctccgcagtctgcggccgctcgacgacgccacgatcatggagtcg
gtcagccgtacccaccgcgcggtgatcgtcgacgagggctggcgttcgggcagtctggcc
gccgagataagcgcccgcatcaccgaacaggccttctacgacctggacgcacccgtggaa
agggtgtgttcggccgaagtgcccatgccctacgcgcggcacctggaacaggccgcgcta
ccgcgtccgtccgacgtggcggcttcggtgaggcggacggtgaactga

KEGG   Stackebrandtia nassauensis: Snas_4794Help
Entry
Snas_4794         CDS       T01194                                 

Definition
(GenBank) 2-oxo-acid dehydrogenase E1 subunit, homodimeric type
  KO
K00163  pyruvate dehydrogenase E1 component [EC:1.2.4.1]
Organism
sna  Stackebrandtia nassauensis
Pathway
sna00010  Glycolysis / Gluconeogenesis
sna00020  Citrate cycle (TCA cycle)
sna00620  Pyruvate metabolism
sna01100  Metabolic pathways
sna01110  Biosynthesis of secondary metabolites
sna01120  Microbial metabolism in diverse environments
sna01200  Carbon metabolism
Module
sna_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Snas_4794
   00020 Citrate cycle (TCA cycle)
    Snas_4794
   00620 Pyruvate metabolism
    Snas_4794
Enzymes [BR:sna01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     Snas_4794
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PDH_E1_M Transketolase_N Transketolase_C
Motif
Other DBs
NCBI-ProteinID: ADD44435
UniProt: D3Q8J3
LinkDB All DBs
Position
5088001..5090760
Genome map
AA seq 919 aa AA seqDB search
MQREQPVTNERKRPVISDGLPSQLPDIDPQETAEWLESLDGLVDEQGRQRARYVMLRMLE
RARESQVGVPALTSTDYINSIPPEAEPWFPGDEHVERRIRAYIRWNAAMMVHRAQRPGIG
VGGHISTYASAASLYEVGFNHFFKGKQHAGGGDQIYIQGHGSPGIYARAYLEGRLTEHQM
DGFRQELSHPGGGLPSYPHPRLMPDFWEFPTVSMGLGPQGAIYQAQFNRYLQHRGIKDTS
QQRVWAFLGDGEMDEPESLGAIHLAAREELDNLTFVVNCNLQRLDGPVRGNGKIIQELES
FFRGAGWNVIKVIWGREWDSLLAADTDGALVNIMNSTPDGDYQTFKAEDGGFVREHFFGR
DPRTKRMVEPLTDEQVWNLKRGGHDYRKLFAAYKAATEHTGQPTVILAKTIKGWTLGSHF
EGRNATHQMKKLTLDDLKSFRDRLYLDIPDSALEENPYLPPYFHPGKGSDEIEYMMERRK
SLGGPVPTRRTKHKALELPPSSTYDVVKKGSGKQKVATTMAFVRLLKDLMKDKNIGPRWV
PIIPDEARTFGMDAMFPTSKIYSPHGQNYLSVDRDLFLSYKEAEKGQILHLGINESGSSS
AFIAAGTSYATHDEPMIPMYIFYSMFGFQRTGDHLWAAADQMTRGFLLGATAGRTTLNGE
GLQHEDGHSPLLAATNPAVLTYDPAFGYEVAHIVEDGLRRMYGEKQENIFYYLTVYNEPI
TQPAQPDGLDVNGVLKGIYKYRSAADNANLPKVRLLASGVSMQWALKAAELLAADWGVSA
DVYSVTSWTELRRDAVACEEANLLNPDAEEQVPFITQQLSDGSGPVVAVSDFMRAVPDLI
SRWVPGEYTSLGTDGFGQSDTRGALRRHFHVDGESIAVAALRQLARRGDLPTEAAAQAAR
KYAIEDVSAAEAGETGGDS
NT seq 2760 nt NT seq  +upstreamnt  +downstreamnt
atgcagagggaacagcccgtgaccaacgaacgtaaacgtccggtcatcagtgacggcctt
ccgagccagctgccggacatcgatccgcaggagaccgccgaatggctcgagtcgctggac
gggcttgtggacgaacaggggcggcagcgcgcccggtacgtgatgctgcggatgctggaa
cgggcccgggagagccaggtcggggttcccgcgctgaccagcaccgactacatcaactcc
atcccgccggaggccgagccctggttccccggtgacgagcacgtcgagcgccgcatccgg
gcctacatccgctggaacgcggccatgatggtgcaccgggcccagcggcccgggatcggc
gtcggcggccacatctcgacctacgcctcggcggccagcctgtacgaggtgggcttcaac
cacttcttcaagggcaagcagcacgccggtggcggcgaccagatctacatccagggccac
ggctcgccgggcatctacgcccgcgcctacctggaggggcggctgaccgagcaccagatg
gacgggttccggcaggaactgtcgcacccgggcggggggctgccgtcctacccgcacccg
cggctgatgccggacttctgggagttcccgaccgtgtcgatgggtctgggtccgcagggc
gcgatctaccaggcccagttcaaccggtacctccagcaccggggcatcaaggacacctcg
cagcagcgggtgtgggcgttcctgggcgacggcgagatggacgagccggaatcgctgggt
gccatccacctggccgcccgcgaggagctcgacaacctgacctttgtggtcaactgcaac
ctgcagcggctcgacgggccggtgcgcggcaacggcaagatcatccaggagctggagtcg
ttcttccggggcgcgggctggaacgtcatcaaggtgatctggggccgcgagtgggactcg
ctgctggccgccgacaccgacggcgcgctggtcaacatcatgaactccacacccgacggt
gactaccagaccttcaaggccgaggacggcggcttcgtccgcgagcacttcttcggccgc
gacccgcgcaccaagcggatggtcgagccgctgaccgacgagcaggtgtggaacctcaag
cgtggtggccacgactaccggaagctgttcgcggcgtacaaggccgccaccgagcacacc
ggacagccgacggtgatcctggccaagaccatcaagggctggacgctgggctcgcacttc
gagggccgcaacgccacccaccagatgaagaagctgaccctggacgacctgaagtcgttc
agggaccggctgtacctcgacatcccggactcggcgctggaggagaacccgtacctgccg
ccgtacttccacccgggcaagggttccgacgagatcgagtacatgatggagcgacgcaag
tcgctcggcggtccggttccgacgcggcgcaccaagcacaaggcgctggagctgccgccg
tcgtcgacctacgacgtggtcaagaagggctcgggcaagcagaaggtcgccaccacgatg
gccttcgtccggctgctgaaggacctgatgaaggacaagaacatcggtccgcgctgggtg
ccgatcatcccggacgaggcgcgcaccttcgggatggacgcgatgttcccgacctcgaag
atctactcgccgcacgggcagaactacctgtcggtggaccgcgacctgttcctgtcgtac
aaggaagccgagaaggggcagatcctgcacctgggcatcaacgagtccggctcgtccagc
gcgttcatcgcggcggggacctcgtacgccacccatgacgagccgatgatcccgatgtac
atcttctactcgatgttcgggttccagcggaccggcgaccacctgtgggcggcggccgac
cagatgacccgcggcttcctgctgggcgccacggccggacgcacgacgctcaacggcgag
ggcctgcaacacgaggacggccactccccgctgctggcggccaccaacccggcggtgctc
acctacgacccggccttcgggtacgaggtggcgcacatcgtcgaggacggtctgcgccgc
atgtacggggagaagcaggagaacatcttctactacctgaccgtctacaacgaaccgatc
acgcagcccgcgcagccggacggcctggacgtcaacggcgtcctcaagggaatctacaag
taccgttcggcggcggacaacgccaacctgccgaaggtgcggctgctggcgtcgggcgtc
agcatgcagtgggcgctcaaggccgccgagctgttggcggcggactggggcgtgtcggcc
gacgtgtactcggtgacctcgtggacggagctgcgtcgcgacgcggtcgcgtgcgaggag
gccaacctgctcaacccggacgccgaggagcaggtcccgttcatcacccagcagctgtcg
gacggctccggcccggtggtcgcggtcagcgacttcatgcgcgcggtaccggacctgatc
tcccgctgggtacccggcgagtacacctcgctgggaaccgacggcttcggccagtccgac
acgcggggtgcactgcggcgtcacttccatgtggacggtgaatcgatcgcggtggcggcg
ctgcgccagctggcccgccgcggcgacctgcccaccgaagcggcggcccaggcggcccgc
aagtacgccatcgaggacgtctcggcggccgaagccggtgagaccggcggcgactcgtaa

KEGG   Stackebrandtia nassauensis: Snas_6068Help
Entry
Snas_6068         CDS       T01194                                 

Definition
(GenBank) pyruvate dehydrogenase (acetyl-transferring) E1 component, alpha subunit
  KO
K00161  pyruvate dehydrogenase E1 component alpha subunit [EC:1.2.4.1]
Organism
sna  Stackebrandtia nassauensis
Pathway
sna00010  Glycolysis / Gluconeogenesis
sna00020  Citrate cycle (TCA cycle)
sna00620  Pyruvate metabolism
sna01100  Metabolic pathways
sna01110  Biosynthesis of secondary metabolites
sna01120  Microbial metabolism in diverse environments
sna01200  Carbon metabolism
Module
sna_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Snas_6068
   00020 Citrate cycle (TCA cycle)
    Snas_6068
   00620 Pyruvate metabolism
    Snas_6068
Enzymes [BR:sna01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     Snas_6068
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1_dh TPP_enzyme_C DXP_synthase_N
Motif
Other DBs
NCBI-ProteinID: ADD45692
UniProt: D3Q1B2
LinkDB All DBs
Position
6423425..6424582
Genome map
AA seq 385 aa AA seqDB search
MVNGDQTRSGPKAKSPARRKKTPVGDPDMVQLLTPDGKRVSHPDYAVDLTDEEYRGLYRD
MVIVRRLDSEGTALQRQGQLGIWASLLGQEAAQIGSGRALAAQDMVFPTYREHGVLWTKG
IDPIMPFGLFRGVDLGGWDSRKYKFQMYTIVIGAQTLHATGYAMGITMDGKVGTDDGEAV
IAYFGDGASSQGDVNESLVFSSVYNSPIVFFCQNNQYAISEPVFRQAKAPLFKRADGFGF
PGVRVDGNDVLATYAVTKTAMDNARSGNGPTFIEAFTYRMGAHTTTDDPTRYRDSVEVDQ
WKAKDPISRMRTFLEAEKLADADWLAGVDAEADEHALSLRERVISMPDPDPDSMFQHVFR
EGSPLVDSERAAFADYHASFEGSEH
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atggtcaacggcgaccaaacccgtagtggtcccaaagccaaatcgcccgcgcggcgaaag
aagacaccggtcggcgaccccgacatggtgcagctgttgacgcccgacggaaagcgggtg
tcgcacccggactacgccgtcgatctgacggacgaggagtatcgcggactctaccgcgac
atggtgatcgtccgcaggctcgactccgagggaaccgccctgcaacggcagggccagctg
ggcatctgggccagcctgctcggccaggaggccgcccagatcggctccggacgcgcgctc
gcggcgcaggacatggtgttcccgacctatcgcgagcacggcgtcctgtggaccaagggc
atcgacccgatcatgccgttcgggctgtttcggggcgtcgacctcggcggctgggactcg
cgcaagtacaagttccagatgtacacgatcgtcatcggcgcccagaccctgcacgccacc
ggctacgccatgggcatcaccatggacggcaaggtgggcaccgacgacggcgaggccgtc
atcgcctacttcggggacggcgcctccagccagggagacgtcaacgagtcgctggtgttc
tccagcgtctacaactcaccgatcgtgttcttctgccagaacaaccagtacgcgatctcc
gagccggtcttccggcaggccaaggccccactgttcaaacgcgccgacggcttcggcttc
cccggcgtacgcgtggacggcaacgacgtgctggccacctacgcggtcaccaagaccgcc
atggacaacgcccgctccggcaacggccccaccttcatcgaggcgttcacttaccggatg
ggcgcccacaccaccaccgacgacccgacccgctaccgcgactcggtcgaggtcgaccag
tggaaggccaaggacccgatctcgcggatgcgcaccttcctggaggccgagaagctcgcc
gacgccgactggctggccggtgtcgacgccgaggccgacgagcacgccctgagtctgcgc
gagcgggtcatctcgatgcccgacccggacccggactcgatgttccagcacgtattccgg
gagggctcgccgctggtcgacagcgagcgcgccgcattcgccgactaccacgcgtccttc
gaggggagtgagcactga

KEGG   Stackebrandtia nassauensis: Snas_6069Help
Entry
Snas_6069         CDS       T01194                                 

Definition
(GenBank) Transketolase central region
  KO
K00162  pyruvate dehydrogenase E1 component beta subunit [EC:1.2.4.1]
Organism
sna  Stackebrandtia nassauensis
Pathway
sna00010  Glycolysis / Gluconeogenesis
sna00020  Citrate cycle (TCA cycle)
sna00620  Pyruvate metabolism
sna01100  Metabolic pathways
sna01110  Biosynthesis of secondary metabolites
sna01120  Microbial metabolism in diverse environments
sna01200  Carbon metabolism
Module
sna_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Snas_6069
   00020 Citrate cycle (TCA cycle)
    Snas_6069
   00620 Pyruvate metabolism
    Snas_6069
Enzymes [BR:sna01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     Snas_6069
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr Transketolase_C PFOR_II
Motif
Other DBs
NCBI-ProteinID: ADD45693
UniProt: D3Q1B3
LinkDB All DBs
Position
6424582..6425568
Genome map
AA seq 328 aa AA seqDB search
MTDTLRIGGAIGAGLRKAMEDDPKVLIMGEDVGKLGGVFRVTDGLQKDFGEDRVIDTPLA
ESGIVGTAIGLAIRGYRPVVEIQFNGFVYPAFDQIVSQLAKMHNRSQGTVPMPVVVRIPC
GGGIGAVEHHSESPEAYFAHTAGLKCVSVSNPHDAYWKIQQAIASDDPVIFFEPLRRYQE
KGEVDLSGTLADADPLLSAKVERAGDHVTVVAWGSMMKVAHDAAGAAADEGRQLEVINLR
ALSPMDMEPIYASVRKTGRLVVVHEAPSNVGIASEIATRVSQECFYSLESPVLRVTGYDT
PYPAARLEEEYLPDLDRVLDAVDRTFTY
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacacacttcgcatcggcggcgccatcggcgccggtctgcgcaaggccatggag
gacgaccccaaggtcctgatcatgggtgaggacgtcggcaagctcggcggcgtcttccgc
gtcaccgacggactccagaaggacttcggcgaggaccgggtcatcgacaccccgctggcc
gagtccgggatcgtgggaaccgcgatcggtctggccatccggggctaccgcccggtggtg
gagatccagttcaacggcttcgtctacccggccttcgaccagatcgtgtcgcagctggcc
aagatgcacaaccgctcgcagggcaccgtcccgatgccggtggtggtgcggatcccttgt
ggcggcggcatcggcgcggtcgagcaccactcggagtccccggaggcgtacttcgcccac
accgcggggctgaagtgcgtctcggtgtcgaacccgcacgacgcctactggaagatccag
caggccatcgcctccgacgacccggtgatcttcttcgaaccgctgcggaggtaccaggag
aagggcgaggtcgacctgtccggaaccctcgccgacgccgacccgctgctgtcggcgaag
gtcgagcgcgccggtgaccacgtcaccgtcgtggcctggggttcgatgatgaaggtcgcc
cacgacgccgcgggtgccgcggccgacgagggccgccagctggaggtcatcaacctgcgt
gccctgtcccccatggacatggaaccgatctacgcctcggtccgcaagaccggccgtctc
gtcgtcgtccacgaagcaccgtccaacgtgggcatcgcttccgagatcgcgacccgggtc
tcccaggagtgcttctactcgctggagtccccggtgctgcgggtgaccggctacgacacc
ccctacccggccgcgcgcctcgaagaggagtatctgcccgatttggaccgtgtcctcgac
gcggtcgaccggacgttcacttactag

DBGET integrated database retrieval system