KEGG   Stackebrandtia nassauensis: Snas_4199Help
Entry
Snas_4199         CDS       T01194                                 

Definition
(GenBank) dihydrolipoamide dehydrogenase
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
sna  Stackebrandtia nassauensis
Pathway
sna00010  Glycolysis / Gluconeogenesis
sna00020  Citrate cycle (TCA cycle)
sna00260  Glycine, serine and threonine metabolism
sna00280  Valine, leucine and isoleucine degradation
sna00310  Lysine degradation
sna00380  Tryptophan metabolism
sna00620  Pyruvate metabolism
sna00630  Glyoxylate and dicarboxylate metabolism
sna00640  Propanoate metabolism
sna01100  Metabolic pathways
sna01110  Biosynthesis of secondary metabolites
sna01120  Microbial metabolism in diverse environments
sna01200  Carbon metabolism
Module
sna_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sna_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sna_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Snas_4199
   00020 Citrate cycle (TCA cycle)
    Snas_4199
   00620 Pyruvate metabolism
    Snas_4199
   00630 Glyoxylate and dicarboxylate metabolism
    Snas_4199
   00640 Propanoate metabolism
    Snas_4199
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Snas_4199
   00280 Valine, leucine and isoleucine degradation
    Snas_4199
   00310 Lysine degradation
    Snas_4199
   00380 Tryptophan metabolism
    Snas_4199
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sna04147]
    Snas_4199
Enzymes [BR:sna01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     Snas_4199
Exosome [BR:sna04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Snas_4199
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 GIDA HI0933_like FAD_binding_2 DAO AlaDh_PNT_C Lycopene_cycl NAD_binding_8 FAD_oxidored Thi4 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: ADD43849
UniProt: D3Q2B6
LinkDB All DBs
Position
4497126..4498511
Genome map
AA seq 461 aa AA seqDB search
MSDPNAGYDVVILGSGSAGYACALRAAQLDLSVAIIEKDKLGGTCLHTGCIPTKALLHAG
EVADSARHGEEFGVKTEGVSIDMAGVNAYKDGVVAKMYKGLQGLIKASKVTVIEGSGKLV
GPNTVEVNGERVTGRNIVLATGSYSKSLPGLDVDGTKVITSEHALRLDKVPSSAIVLGGG
VIGVEFASAWKSLGADVTIVEALPRLVAAEDADSSKMLERAFRKRGIKFKTGKGFESLKE
TAGGVSVTIAGGETIDAELLLVAVGRGPSTAGLGYDEQGVSMDRGFVLVNEHLQTNLPGV
YAIGDIVPGVQLAHRGFGHGIFVAEHIAGLNPRPIDEAGIPKVTYSEPQVASVGYSEEAA
KEKFGADVVVSYNYNLGGNGKSNILKTQGFVKLVSVKDGPVVGVHMVGANMGEQIGEAQL
IYNWEAFPSDVAQLIHMHPTQNEALGEAHLALAGKPLHAHA
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgacccgaacgcgggctacgacgtcgtaatcctgggtagcggcagcgccggttat
gcctgcgccctgcgggcagcccaactcgacttgagcgtcgccatcatcgagaaggacaag
ctggggggcacctgcctgcacaccggctgcataccgaccaaggcgctgctgcacgccggc
gaggtcgccgactcggcccggcacggcgaggagttcggggtcaagaccgagggcgtctcc
atcgacatggccggtgtcaacgcctacaaggacggcgtggtcgccaagatgtacaagggc
ctgcagggcctcatcaaggccagcaaggtcaccgtcatcgagggctccggcaagctggtc
ggccccaacaccgtcgaggtcaacggggaacgcgtcaccggacgcaacatcgtgctggcc
accggctcgtactccaagtcgctgcccggcctcgacgtcgacggcaccaaggtgatcacc
tccgagcacgcgctccgcctcgacaaggttccctccagcgccatcgtgctgggcggcggc
gtcatcggcgtcgagttcgccagcgcctggaagtcgctgggcgccgatgtcaccattgtg
gaggctctgccccgtctggtggccgccgaggacgccgactcgtcgaagatgctggagcgg
gccttccgcaagcgcggcatcaagttcaagaccggcaagggcttcgagtcgctcaaggag
accgccgggggcgtgtcggtcacgatcgcgggcggcgagaccatcgacgccgagctgctg
ctggtggccgtcggccgcggcccctccaccgccggcctgggctacgacgagcagggcgtg
tccatggaccgcggcttcgtcctggtcaacgagcacctgcagaccaacctgccgggcgtg
tacgccatcggcgacatcgtcccgggtgtgcagctggcgcaccgcggcttcgggcacggc
atcttcgtcgccgagcacatcgcgggcctgaacccgcgtcccatcgacgaggccgggatc
ccgaaggtgacctacagcgagccgcaggtggcctcggtgggctactccgaggaagccgcc
aaggagaagttcggcgccgacgtcgtggtgtcgtacaactacaacctcggcggcaacggc
aagagcaacatcctcaagacccagggcttcgtcaagctcgtcagcgtcaaggacggaccg
gtcgtgggtgtccacatggtcggcgccaacatgggtgagcagatcggtgaggcgcagctg
atctacaactgggaggccttcccgtcggacgtcgcccagctgatccacatgcacccgacc
cagaacgaggctctcggcgaggcgcacctggctctcgcgggcaagccactgcacgcacac
gcctaa

DBGET integrated database retrieval system