KEGG   Stackebrandtia nassauensis: Snas_4970Help
Entry
Snas_4970         CDS       T01194                                 

Definition
(GenBank) aminotransferase class-III
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
sna  Stackebrandtia nassauensis
Pathway
sna00250  Alanine, aspartate and glutamate metabolism
sna00410  beta-Alanine metabolism
sna00640  Propanoate metabolism
sna00650  Butanoate metabolism
sna01100  Metabolic pathways
sna01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Snas_4970
   00650 Butanoate metabolism
    Snas_4970
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Snas_4970
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Snas_4970
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sna01007]
    Snas_4970
Enzymes [BR:sna01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Snas_4970
Amino acid related enzymes [BR:sna01007]
 Aminotransferase (transaminase)
  Class III
   Snas_4970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: ADD44608
UniProt: D3Q9R2
LinkDB All DBs
Position
complement(5281102..5282397)
Genome map
AA seq 431 aa AA seqDB search
MEHKALTDRHRAVLPNWVSPMYAEPIEFVSASGRRVVDATGKSYLDFFGGVLTTMVGYDI
PEIREAVDRQLSTGITHSSTLYLIRNQVILAEKIAAVSGIPDAKVFLGNSGSEATETALL
LATQYRRSNQILAMRNSYHGRTFGAVGVTGNKGWSASALTPFNVSYLHSGDRLRGLFAGM
SDAEYIERSVADLREVLATTTSGDVACLIAEPIQGVGGFVMPPDGYFKAIQEVLAEHGIL
WVCDEVQTGWGRTGSHLWGYQAHDAVPDILTFAKGIGNGFALGGVVARAEVMDCLSAISF
NTFGGNPLAAAAGIAVLDYLRDNDLQHNAARTGAIIHAGLTEQARRSPIVAEVRGKGLMI
AIEFVAADTTRPDPAAALRVLEACRRDGLLVGKGGLYGNVIRMGPPLTLTESEAAEGLAI
LTNAIDEEAAS
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
gtggaacacaaagcattgaccgaccggcaccgagcagtgcttcccaactgggtgagtccg
atgtacgccgaaccgatcgagttcgtctcggcctcgggtcgccgcgtcgtcgacgccacc
ggaaagtcctacctggacttcttcggcggggtactgaccacgatggtcggctacgacatc
cccgagatccgcgaggccgtcgaccggcagctcagcaccggcatcacccactcctcgacc
ctgtacctgatccgcaaccaggtcatcctcgccgagaagatcgccgccgtgtccggcatc
cccgacgccaaggtcttcctcggcaacagcggctccgaggccaccgagacggcactgctg
ctggccacccagtaccggcgcagcaaccagatcctggccatgcgcaacagctaccacggc
cgcaccttcggcgccgtcggcgtcaccggcaacaagggatggtcggcctcggccctcacc
ccgttcaacgtcagctacctccactccggagaccggctgcggggcctgttcgcgggaatg
tccgacgcggagtacatcgagcgctccgtggccgacctgcgcgaagtactggccaccacc
acctccggcgacgtcgcctgcctgatagccgaaccgatccagggcgtcggcggcttcgtc
atgccgcccgacggctacttcaaggccatccaagaagtgctcgccgaacacggcatcctg
tgggtctgcgacgaagtccagaccggctggggccgcaccggctcgcacctgtggggctac
caggcccacgacgcggtacccgacatcctcaccttcgccaagggcatcggcaacggcttc
gccctcggcggcgtcgtggcccgcgccgaggtcatggactgcctgtcggcgatctccttc
aacaccttcggcggcaacccgctcgccgccgcggcgggcatcgccgtcctggactacctg
cgggacaacgacctgcaacacaacgccgcccgcaccggagccatcatccacgccggtctg
accgaacaggcgcgacgctcaccgatcgtcgccgaggtccgcggcaagggcctcatgatc
gccatcgagttcgtcgcggccgacaccacccgccccgacccggccgccgccctgcgggtc
ctggaagcctgccgacgcgacggtctgctggtcggcaagggcggcctgtacggcaacgtc
atccgcatggggccacccctgaccctcaccgaatccgaagccgccgaaggactcgccatc
ctcaccaacgcgatcgacgaggaggccgcctcgtaa

DBGET integrated database retrieval system