KEGG   Stackebrandtia nassauensis: Snas_4988Help
Entry
Snas_4988         CDS       T01194                                 

Definition
(GenBank) D-alanine/D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
sna  Stackebrandtia nassauensis
Pathway
sna00473  D-Alanine metabolism
sna00550  Peptidoglycan biosynthesis
sna01100  Metabolic pathways
sna01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sna00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    Snas_4988
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Snas_4988
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    Snas_4988
Enzymes [BR:sna01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Snas_4988
Peptidoglycan biosynthesis and degradation proteins [BR:sna01011]
 Precursor biosynthesis
  Amino acid ligase
   Snas_4988
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATPgrasp_ST ATP-grasp_4 ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: ADD44625
UniProt: D3Q9S9
LinkDB All DBs
Position
complement(5295529..5296623)
Genome map
AA seq 364 aa AA seqDB search
MKKTKVAVVLGGRSVEHPVSCASAAGVIAALDPEQYEVVAVGITQAGQWLSVDARSAKLA
LGDGNVPEISADSGQHVVLAADPTMKDVAITDAAGGARVLSDVDVVFPVLHGAYGEDGTI
QGLLEMADVPYVGSNVLSSAASMDKDFMKRLLKAEGIPVGDYVVLKRDQTLSEAEKQRLG
LPVFVKPSRAGSSLGISKVTDWDDLDKAIATARAVDPKVLVEAAFTGVRELECGVLERED
GGAPDTTPPFEVLIAGTEGWFDFEAKYLASGSPYDLAPDLPEGTAERIRELAARVFTVMD
CSDLARVDFFLASDGTVYVNEINTMPGLTPGSGVPVAWANAGVDYPELVARLVRLAANRG
TGLR
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagacgaaggtcgccgttgtcctgggtggacgaagcgttgagcacccggtctcg
tgcgcgagcgcggcgggcgtcatcgccgccctcgacccggagcagtacgaggtcgtggcg
gtgggcatcacgcaggccggacagtggctgtcggtggacgcgcgatcggcgaagctggcg
ctgggcgacggcaacgtgcccgagatcagcgccgactccggccagcacgtggtgctggcc
gcggatccgaccatgaaggacgtcgcgatcaccgacgccgcgggcggcgcccgggtactg
tccgacgtggacgtcgtcttcccggtgctgcacggggcctacggcgaggacggcaccatc
cagggactgctggagatggccgacgtcccctacgtcggcagcaacgtcctgtcctcggcg
gccagtatggacaaggacttcatgaagcggctgctcaaggccgagggcatcccggtgggg
gactacgtcgtcctcaaacgcgaccagaccctgtcggaggcggagaagcagcggctcggg
ctgccggtgttcgtcaagccctcgcgcgccggttccagcctgggcatcagcaaggtcacc
gactgggacgacctggacaaggcgatcgcgaccgcccgcgccgtcgaccccaaggtcctg
gtggaggccgccttcaccggggtgcgggaactggagtgcggggtgctggagcgcgaggac
ggcggcgcgccggacaccaccccgccgttcgaggtgctgatcgccggaaccgagggctgg
ttcgacttcgaggccaagtacctcgcgtccggctccccctacgacctggcgccggacctg
cccgagggcaccgccgagcggatccgggaactggccgcgcgggtgttcaccgtgatggac
tgctcggacctggcccgggtggacttcttcctggcctccgacggcaccgtctacgtcaac
gagatcaacacgatgccgggcctgacccccggttccggggtcccggtggcctgggccaac
gccggggtcgactaccccgaactggtggcgcggctggtgcggctggccgccaaccggggc
accggactgcggtag

DBGET integrated database retrieval system