KEGG   Stackebrandtia nassauensis: Snas_5050Help
Entry
Snas_5050         CDS       T01194                                 

Definition
(GenBank) phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
sna  Stackebrandtia nassauensis
Pathway
sna00010  Glycolysis / Gluconeogenesis
sna00030  Pentose phosphate pathway
sna00051  Fructose and mannose metabolism
sna00052  Galactose metabolism
sna00680  Methane metabolism
sna01100  Metabolic pathways
sna01110  Biosynthesis of secondary metabolites
sna01120  Microbial metabolism in diverse environments
sna01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Snas_5050
   00030 Pentose phosphate pathway
    Snas_5050
   00051 Fructose and mannose metabolism
    Snas_5050
   00052 Galactose metabolism
    Snas_5050
  09102 Energy metabolism
   00680 Methane metabolism
    Snas_5050
Enzymes [BR:sna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Snas_5050
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Snas_5050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK Peripla_BP_6 NAD_kinase
Motif
Other DBs
NCBI-ProteinID: ADD44687
UniProt: D3QAP1
LinkDB All DBs
Position
complement(5357930..5358955)
Genome map
AA seq 341 aa AA seqDB search
MRIGVLTGGGDCPGLNAVIRAVVRKGVQQYGHEFVGFRDGWRGPIENKTTPLGVNEVRGI
LPRGGTILRSSRTNPYKVDGGVDKVRSTLTELGVDALIAIGGEDTLGVAKKLTDDGIPVV
GVPKTIDNDLGATDYTFGFDTAVNIASEAIDRLHTTAESHHRCVVVEVMGRHAGWIALHS
GLAGGANAILVPEKRFSVAEVVRFVESRFEIDYSPIVVVAEGAQPAEGEMVTQDKGLDAF
GHVRLGGIGQWLSDEIEKHTGKESRAVVLGHVQRGGTPTAYDRVLATRFGLHAIDAIHEG
DYGKMVALRGTDIVRVELSEATAELKTVPAERLAEAEVFFG
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcataggtgtcttgaccggaggcggagactgccccggtctcaatgccgtcatccgg
gctgtggtccgcaagggagtacagcagtacggccacgagttcgtcgggttcagggacggc
tggcgtggccccatcgagaacaagacgaccccgttgggcgtcaacgaggttcgcggcatc
ctgccgcgcggtggaaccatcctgcgctcctcgcgcaccaacccctacaaggtggacggc
ggagtcgacaaggtacggtccacactgaccgaactgggtgtcgacgcgctgatcgccatc
ggcggcgaggacaccctcggcgtggccaagaagctcaccgacgacggcatcccggtcgtg
ggcgttcccaagaccatcgacaacgacctcggcgccaccgactacaccttcggcttcgac
accgccgtcaacatcgcctccgaggccatcgaccggctgcacaccaccgccgagagccac
caccgctgcgtggtcgtcgaggtcatgggccgccacgccggctggatcgcgctccactcc
ggactcgccggtggcgccaacgccatcctggtgcccgagaagcggttcagcgtcgccgag
gtggtgcgcttcgtcgagtcccgcttcgagatcgactactcgccgatcgtcgtggtcgcc
gagggcgcccagcccgccgagggcgagatggtcacccaggacaagggcctggacgccttc
gggcacgtgcgactgggcggcatcggccagtggctgtccgacgagatcgagaagcacacc
ggcaaggagtcccgggccgtggtcctgggtcacgtgcagcgcggcggcacccccaccgcc
tacgaccgggtgctggccacccgcttcgggctgcacgccatcgacgcgatccacgagggc
gactacggcaagatggtcgcgctgcgcggcaccgacatcgtccgggtggaactgtcggag
gccaccgccgagctcaagaccgttccggccgaacggctcgccgaggccgaggtcttcttc
ggttaa

DBGET integrated database retrieval system