KEGG   Stackebrandtia nassauensis: Snas_5159Help
Entry
Snas_5159         CDS       T01194                                 

Definition
(GenBank) superoxide dismutase, Ni
  KO
K00518  nickel superoxide dismutase [EC:1.15.1.1]
Organism
sna  Stackebrandtia nassauensis
Brite
KEGG Orthology (KO) [BR:sna00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Snas_5159
Enzymes [BR:sna01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Snas_5159
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Ni Phage_clamp_A
Motif
Other DBs
NCBI-ProteinID: ADD44794
UniProt: D3QAZ8
LinkDB All DBs
Position
5484308..5484724
Genome map
AA seq 138 aa AA seqDB search
MRLSRLLTSRFFVPQTTASAHCDLPCGVYDPAQARIEAESVKAICEKYQANEDPEFRTRA
LLIKEQRSELVKHHLWVLWTDYFKPPHFEAYPQLHVLVNEATKLAGASGAKGSADPEVAD
KLLGKIDEIAKIFWETKK
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgcgcctatctcggctgctgacatctcgctttttcgtcccgcaaaccacggcctcggca
cactgtgacctgccctgtggtgtctacgaccccgctcaggcccgcatcgaggccgagtcg
gtcaaggcgatctgcgagaagtaccaggccaatgaggacccggagttccgcactcgcgcg
ctgctcatcaaggagcagcggtccgagctggtcaagcaccacctgtgggtactgtggacg
gattacttcaagccgccgcacttcgaggcgtacccgcagctgcacgttctcgtgaacgag
gccaccaagctcgccggtgcctcgggcgcgaagggatcggccgacccggaagtggccgac
aagctgctcggcaagatcgacgagatcgccaagatcttctgggagaccaagaagtag

DBGET integrated database retrieval system