KEGG   Stackebrandtia nassauensis: Snas_5310Help
Entry
Snas_5310         CDS       T01194                                 

Definition
(GenBank) Catalase
  KO
K03781  catalase [EC:1.11.1.6]
Organism
sna  Stackebrandtia nassauensis
Pathway
sna00380  Tryptophan metabolism
sna00630  Glyoxylate and dicarboxylate metabolism
sna01110  Biosynthesis of secondary metabolites
sna01130  Biosynthesis of antibiotics
sna01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Snas_5310
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    Snas_5310
Enzymes [BR:sna01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     Snas_5310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Catalase Catalase-rel DJ-1_PfpI
Motif
Other DBs
NCBI-ProteinID: ADD44944
UniProt: D3PUS0
LinkDB All DBs
Position
complement(5639638..5641746)
Genome map
AA seq 702 aa AA seqDB search
MTHEQADDPKDRQLGRDRVDDTDATLTTQQGVQVDHTDDSLSIGERGPTIMEDFHAREKL
THFDHERIPERVVHARGAGAYGHFKPYDSWLSEYTSAGFLTDPARQTPVFVRFSTVAGSR
GSADTVRDVRGFATKFYTRQGNYDLVGNNMPVFFIQDGVKFPDFVHAVKPEPHNEIPQAA
SAHDTLWDFVSLQPETLHMILWLMSDRALPRSYRMMQGFGVHTFRLVNAEGRGTFVKFHW
TPKLGTHSLVWDEAQKIAGKDPDFNRRDLWDSIEAGEFPEWELGVQLVDEADESEFDFDL
LDATKLIPEERVPVRPVGRMVLDRNPDNFFAETEQVAFHTANLVPGIDFSNDPLLQARNF
SYLDTQLIRLGGPNFAQLPVNRPVAEVHNDQRDGYGQHRIHTSRTSYTKNTLSGGCPVLA
DSGAFSHYAEKIEGHKIRERSDSFKDFYSQATLFWNSMSEVEAEHLVAAFRFELGKVEDT
DIRARVVEELNHVDHSLARRVAEGVGVEPPAKETTANHGRSSAALSQLNTRLDQPATRKV
AILVADGVDGDGTERLVASLRAQGLIPEKLAPTAGSVRAAGGGEIAVDRAINTMASVLYD
GVAVPCGSESVATLSVDGYALHFVAEAYKHAKPIACFGSGLDMLRAAGVNAELAATTEVT
VHLGVVTTTAARDELPDRFTEAFAAQLAAHRVWERNTDTVPA
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atgacacacgaacaggcggacgatccgaaagaccggcagctggggcgggaccgggtggac
gacaccgacgccaccctcaccacccagcagggagtccaggtcgaccacaccgacgactcc
ctgagcatcggcgagcgcgggcccaccatcatggaggacttccacgcccgcgagaaactc
acccacttcgaccacgaacgcatccccgagcgggtggtgcacgcgcgcggcgccggagcc
tacggtcacttcaagccctacgactcctggctgtcggagtacaccagcgccgggttcctg
accgacccggcgcgacagacgccggtcttcgtccggttctccacggtggcgggttcgcgc
ggctcagccgacaccgtccgcgacgtacggggcttcgcgacgaagttctacacccggcag
ggcaactacgacctggtcggcaacaacatgccggtgttcttcatccaggacggcgtcaag
ttccccgacttcgtgcacgcggtgaaacccgagccccacaacgagatcccgcaggccgcc
tccgcgcacgacacgctgtgggacttcgtgtcgctgcaacccgagacgctccacatgatc
ctgtggctgatgtcggaccgggcgctgccgcgtagctaccggatgatgcagggcttcggc
gtccacaccttccggctggtcaacgccgagggccggggcaccttcgtgaagttccactgg
acgcccaaactgggcacgcattcgctggtgtgggacgaggcccagaagatcgcgggcaag
gaccccgacttcaaccgccgcgacctgtgggacagcatcgaagccggtgagttccccgaa
tgggaactgggggtgcagctcgttgacgaggccgacgagtccgagttcgacttcgatctg
ctcgacgcgaccaaactcatcccggaggagcgggtcccggtgcgtccggtgggccggatg
gtcctggaccgcaacccggacaacttcttcgccgagaccgaacaggtcgccttccacacc
gcgaacctggtgccgggcatcgacttcagcaacgacccgctgttgcaggcccgcaatttc
tcctatctggacacccagctgatccggctgggcggacccaacttcgcgcagctgccggtc
aaccggccggtggccgaggtccacaacgaccagcgcgacggctacgggcagcaccggatc
cacacgtcccggacctcgtacaccaagaacaccctcagcggcggctgcccggtcctggcc
gacagcggggccttcagccactacgccgagaagatcgagggccacaagatccgcgagcgc
agcgacagcttcaaggacttctacagccaggccacgctgttctggaacagcatgtccgag
gtggaggccgaacacctcgtcgccgcgttccgcttcgaactgggcaaggtcgaggacacc
gacatccgcgcccgcgtcgtcgaggaactgaaccatgtggaccattcgctggcgcggcgg
gtcgccgaaggcgtcggggtcgaaccaccggccaaggagaccaccgccaaccacggccgc
tcctcggcggcgttgtcgcagttgaacacccgcctggaccagcccgccacccgcaaggtc
gcgatactggtggccgacggcgtggacggcgacggcaccgagcgactggtcgcgagcctg
cgggcgcagggcctcatacccgagaaactggctcccaccgctggcagcgtccgcgccgcg
ggcggcggtgagatcgccgtcgaccgggccatcaacacgatggcgtcggtgctgtacgac
ggcgtcgcggttccctgcggttccgagagtgtcgcgaccctgtcggtggacggttacgcg
ctgcacttcgtcgccgaggcctacaagcacgccaaacccatagcctgcttcggatccggg
ctcgacatgctgcgggccgccggggtcaacgccgaactcgccgccaccacggaggtcacc
gtccacctgggagtggtgaccacgacggcggcccgggacgaactgccggatcgcttcacc
gaggcgttcgccgcgcagctggccgcgcaccgcgtctgggaacgcaacaccgacacggtg
cccgcgtaa

DBGET integrated database retrieval system