KEGG   Stackebrandtia nassauensis: Snas_5805Help
Entry
Snas_5805         CDS       T01194                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sna  Stackebrandtia nassauensis
Pathway
sna00620  Pyruvate metabolism
sna00680  Methane metabolism
sna01100  Metabolic pathways
sna01120  Microbial metabolism in diverse environments
sna01200  Carbon metabolism
Module
sna_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:sna00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Snas_5805
  Energy metabolism
   00680 Methane metabolism
    Snas_5805
Enzymes [BR:sna01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Snas_5805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase Phage_TAC_6
Motif
Other DBs
NCBI-ProteinID: ADD45435
UniProt: D3PZ06
LinkDB All DBs
Position
6168187..6170931
Genome map
AA seq 914 aa AA seqDB search
MDTTLEDDDAGLRADIRRLGSLLGDSLVRQEGQQLLDLVEEIRHLVRTDAKAAAQRLAEL
SVDTGMNLARAFALYFHLANITEQVHRARELRRRRVRRGGWLEEAATEIKAEGLDADRIA
KAARGLEVSPVFTAHPTEAARRSILTKLRQLADVLDSEAAEAALAGQADTAATDLRLAEL
IDLLWQTDEVRINRPEPTDEARNAVYYLTDLYADAAPRVLRDLAQVLTELGAEPSLSDSP
LRFGTWIGGDRDGNPNVTPEVTRRVLTLQHEHGIRAAESMVESMISELSVSQQLRPATPE
FMASLEADLAALPELPPRFRRVNSAEPYRLKARCVRAKLAATRARHASGTAHVPGRDYAD
GTELYTDLETFYDSLTASTGGLAAEGRLADSMRVVAAFGLHLATMDIREHAAKHHAALAE
LFDRLRPDDDLDKPYGDLSRAERFALLAAELDSRRPLLTPAAALSPETRKTLDVFRCIVS
AQRRFGPQVAATYIVSMTQGPDDLLAAAVLAREAGLVDIHAGRADIGFVPLLEGVPELEA
GRQIWNDLLNTPAYRRIVDARGGIQEVMLGYSDSNKESGIAASQWAIQSAQRELRDAAAE
HGVRLRLFHGRGGTVGRGGGPTHEAILAQPYGTLDGTIKVTEQGEVLSDKYTLPVLAREN
LELTVAAVLKATLLHDTPRHDASTLDVWYGTMDRLSGSARTAYRSLIDHPGLPEYFWAVS
PTELLGALNIGSRPAKRPDASAGLDGLRAIPWVFGWTQSRQIVPGWFGVGTGLATAREAV
SDEVLSAMYERWQFFSTFISNVEMTLVKTDMDIAERYVDTLVPPRLRPLFDTIRAEHART
VTEVLRLTGKSELLADNPQLRRTLAVRDRYLAPLHHLQIALLHRHRESATDDPSLTRALL
TTVNGIAAGMRNTG
NT seq 2745 nt NT seq  +upstreamnt  +downstreamnt
gtggacacgactctcgaagacgacgatgccgggctgcgcgccgatatccggcggctgggc
tcgctgctgggtgacagcctggtccgccaggaggggcagcaactgctcgacctggtggag
gagatccggcatctggtgcgcaccgacgccaaggccgccgcgcagcgactggccgagctg
tccgtcgacaccggcatgaacctggcgcgggcgttcgcgctgtacttccacctggccaac
atcaccgaacaggtacaccgggcccgggagctgcggcgccgccgggtacggcgcggcggc
tggctggaggaggccgccaccgagatcaaggccgagggcctggacgccgaccgcatcgcc
aaggcggcgcgcggcctggaggtcagcccggtcttcaccgcgcaccccaccgaggccgcg
cgacgctccattttgaccaaactgcggcagctcgccgacgtgctggactccgaggccgcc
gaggcggcgctggcgggtcaggcggacaccgccgccaccgacctgcggctggcggagctg
atcgatctgctgtggcagaccgacgaggtgcgcatcaaccgccccgagcccaccgacgag
gcccgcaacgccgtctactacctcaccgacctgtacgccgacgccgcgccacgggtgctg
cgggacctggcgcaggtgctcaccgaactgggtgccgaaccgtcgctttcggactctccg
ctgcggttcgggacctggatcggcggcgaccgcgacggcaaccccaacgtcacccccgag
gtcaccaggcgggtgctgacgctgcaacacgagcacggcatccgggccgccgagtccatg
gtggagtcgatgatctcggaactgtcggtctcgcagcaactgcgtccggcgacccccgag
ttcatggccagcctcgaagccgacctggccgcgctgcccgaactgccgccccggttcagg
cgcgtcaactccgccgaaccgtaccggctcaaggcccgctgcgtgcgcgccaaactcgcc
gccacccgggcccggcacgcgtcgggcaccgcgcacgtgcccggccgcgactacgccgac
ggcaccgagctgtacaccgacctggagaccttctacgactcgctgacggcctcgaccggc
ggcctggccgccgagggacggctcgccgactcgatgcgcgtcgtcgccgcgttcggcctc
catctggccacgatggacatccgcgagcacgcggccaagcaccacgccgccctcgccgaa
ctgttcgaccggctgcgtcccgacgacgacctcgacaagccctacggcgacctgtcccgc
gccgagcgcttcgccctgctggcggccgaactcgactcccgccgcccgctgctcaccccg
gcggcggccctgtcccccgagacccgcaagaccctcgacgtgttccgctgcatcgtctcg
gcccaacgccgcttcggaccccaagtcgccgccacctacatcgtgtcgatgacccagggc
cccgacgacctgctcgcggcggccgtcctggcccgcgaggccggactcgtcgacatccac
gccggacgcgccgacatcggcttcgtcccgctgctggaaggcgtcccggaactggaagcg
ggccgccagatctggaacgacctgctcaacacccccgcgtaccgcaggatcgtcgacgcg
cgcggcggcatccaggaggtcatgctcggctactccgactccaacaaggagtccggcatc
gcggccagccagtgggcgatccagtcggcgcaacgcgaactgcgcgacgcggcggccgaa
cacggcgtccggctccgcctgttccacggccggggcggcaccgtcggccgcggcggcggc
cccacccacgaggccatcctcgcccagccgtacggcactttggacggaaccatcaaggtc
accgaacagggcgaagtcctgtccgacaagtacaccctcccggtcctggcccgcgagaac
ctcgaactcacggtcgccgccgtcctcaaggcgaccctcctgcacgacaccccgcgccac
gacgcgtccactctcgacgtctggtacggcaccatggaccgcctcagcggctcggcccgc
accgcctaccgctccctgatcgaccatcccggcctgcccgagtacttctgggcggtctcc
cccaccgaactgttgggcgcgttgaacatcggctcccgcccggccaaacgccccgacgcc
tcggcgggcctggacggcctgcgcgcgatcccgtgggtgttcggctggacccagtcgcgc
cagatcgtgccgggctggttcggcgtcggcaccggcctggccaccgcccgcgaagcggtc
tccgacgaggtcctctcggccatgtacgagcggtggcagttcttctccaccttcatctcc
aacgtcgagatgaccctcgtcaagaccgacatggacatcgccgaacgctacgtcgacacc
ctcgtcccaccccgccttcgcccgctgttcgacaccatccgggccgaacacgcccgaacc
gtcaccgaggtgcttcgcctgacgggcaagtcggagctgctggccgacaacccccaactg
cgccgcaccctggccgtccgcgaccgctacctggcccccctgcaccacctccagatcgca
ctgttgcaccgccaccgcgaatccgccaccgacgaccccagcctgacccgcgccctgctg
accaccgtcaacggcatcgccgccggaatgcgcaacaccggctag

DBGET integrated database retrieval system