KEGG   Stackebrandtia nassauensis: Snas_5835Help
Entry
Snas_5835         CDS       T01194                                 

Definition
(GenBank) Exo-alpha-sialidase
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
sna  Stackebrandtia nassauensis
Pathway
sna00511  Other glycan degradation
sna00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:sna00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Snas_5835
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Snas_5835
Enzymes [BR:sna01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     Snas_5835
Bacterial toxins [BR:sna02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   Snas_5835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BNR_2 BNR_3 BNR Sortilin-Vps10 DUF4185
Motif
Other DBs
NCBI-ProteinID: ADD45465
UniProt: D3PZ36
LinkDB All DBs
Position
complement(6199606..6200784)
Genome map
AA seq 392 aa AA seqDB search
MRLLRPLVIAAVAALTVTAGLLTAGPASAAPDVQTIFTKGENGYGCHRIPAILRAGNGDL
LAFAEARTEFCGDTGHIDLVMKRSTDDGATWGKSQIVLQGTDDDPDAAATRGNPVPILDE
STGRIVLLSTHNPSNADQPRTPYVQHSDDDGQTWSTAKSLGDVIDEPDWGWYATGPGGGI
QLTRGEHAGRLVVGVNFSDGSGKNGAALVYSDDGGETWTRGATDVPATDDIIPQELNLFE
RTDGGIYAAARENAGTNTQTRAFAVSTDAGASFEAPFKLIPDLVGTPKVQGSILRLRATD
SGDSYDRVLFASPVHSKLRMTMTIRSSFDEGKTWQSVDEGTVIDEDRAGYSNMAVLGNGD
IGLLYEAGAYPDGDARDDIRFARISESDLGVP
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgagactgctccgtccgctcgtcatcgcggccgtggccgcgctgaccgtcaccgccggt
ctgctcaccgcaggccccgcctccgccgcccccgacgtccagaccatcttcaccaagggc
gagaacggctacggctgccaccgcatccccgccatcctgcgggccgggaacggcgacctg
ctggccttcgccgaagcccgcaccgagttctgcggcgacaccggccacatcgacctggtc
atgaaacgctccaccgacgacggagcgacctggggcaagtcccagatcgtgctacagggc
accgacgacgaccccgacgcggccgccacccgcggcaacccggtgccgatcctcgacgag
agcaccggccgcatcgtgctgctgtccacacacaacccgtccaacgccgaccagccccgc
accccgtacgtccaacacagcgacgacgacggccagacctggagcaccgccaagagcctc
ggcgacgtcatcgacgaacccgactggggctggtatgccaccggccccggcggcggcatc
cagctcacccggggcgaacacgccggacggctggtcgtgggcgtcaacttctccgacggc
tccggcaagaacggcgccgccctggtctacagcgacgacggcggcgagacctggacccgc
ggtgccaccgacgtccccgcgaccgacgacatcatcccgcaggaactgaacctcttcgag
cgcaccgacggcggcatctacgccgcggcgcgggagaacgcgggcaccaacacccagacc
cgcgccttcgccgtcagcaccgacgccggagccagcttcgaggcgccgttcaagctgatt
cccgacctcgtcggcacacccaaggtccagggctcgatccttcgcctgcgcgccaccgac
tccggcgactcctacgaccgggtgctgttcgcgtcccctgtgcactccaagctgcgcatg
accatgacgatccgctcgtccttcgacgaggggaagacctggcagagcgtcgacgagggc
accgtcatcgacgaggaccgcgccggttactccaacatggccgttctgggcaacggcgac
atcggactcctctacgaagcgggtgcctaccccgacggcgacgcccgcgacgacatccgc
ttcgcccgcatcagcgagtcggatctgggtgtgccgtaa

DBGET integrated database retrieval system