KEGG   Streptococcus pneumoniae 670-6B (serotype 6B): SP670_0915Help
Entry
SP670_0915        CDS       T01308                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
snb  Streptococcus pneumoniae 670-6B (serotype 6B)
Pathway
snb00500  Starch and sucrose metabolism
snb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:snb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SP670_0915
Enzymes [BR:snb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     SP670_0915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase DUF1939 Glyco_hydro_70
Motif
Other DBs
NCBI-ProteinID: ADM90980
LinkDB All DBs
Position
complement(846192..847646)
Genome map
AA seq 484 aa AA seqDB search
MQNQTLMQYFEWYLPHDGQHWTRLAENAPHLAHLGISHVWMPPAFKATNEKDVGYGVYDL
FDLGEFNQKGTVRTKYGFKEDYLQAIQALKEQGIQPMADVVLNHKAAADNREAFQVIEVD
PVDRTVELGEPFTINGWTSFTFDGRQDTYNGFHWHWYHFTGTDYDAKRSKSGIYLIQGDN
KGWANEELVDNENGNYDYLMYADLDFKHPEVIQNIYDWADWFMETTGVAGFRLDAVKHID
SFFMRNFIRDMKEKYGDDFYVFGEFWNPDKEANLDYLEKTEEHFDLVDVRLHQNLFEASQ
AGANYDLRGIFTDSLVELKPDKAVTFVDNHDTQRGQALESTVEEWFKPAAYALILLRQDG
LPCVFYGDYYGISGQYAQEDFKEILDRLLAIRKDLAYGEQNDYFDHANCIGWVRSGAENQ
SPIAVLISNDQENSKSMFVGQEWTNQTFVDLLGNHQGQVTIDEEGYGQFPVSARSVSVWA
VNTI
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatcaaacactcatgcaatactttgaatggtatctgccccacgacggtcaacac
tggacgcgtctggctgaaaatgctccacacctagctcatctggggatcagtcacgtctgg
atgccaccagccttcaaggcaaccaacgaaaaagatgtcggctatggggtctatgactta
tttgacttaggagagttcaaccaaaaagggactgtccgcaccaagtatggtttcaaagaa
gactatcttcaagccattcaagcccttaaagaacagggaattcaacctatggccgatgta
gttctcaaccacaaggctgctgccgataacagggaagcctttcaggttatcgaagttgat
cctgtagaccgtacagttgaacttggagaacccttcaccatcaatggctggactagtttt
accttcgatggtcgccaagatacctataatggcttccactggcattggtaccacttcacc
ggtacagactacgatgccaaacgcagtaaatctgggatttatctgatccaaggggacaac
aagggctgggctaacgaggaattggtcgataacgaaaacggaaactacgactacctcatg
tatgccgacctagactttaaacatcctgaagtcatccaaaacatctatgactgggctgat
tggttcatggaaacgactggtgtagctggtttccgtttggatgccgttaagcatattgac
tctttctttatgcgcaacttcatccgcgatatgaaggaaaaatacggtgacgatttctat
gtttttggtgaattttggaacccagacaaggaagccaatctggactatctcgaaaaaacg
gaagaacactttgaccttgtcgatgttcgtctccaccagaatctctttgaagccagtcaa
gctggcgcaaactatgaccttcgtggcattttcacagatagcctggttgaactcaagcct
gacaaggctgtgacttttgtcgacaaccacgatacccaacgaggacaagcccttgagtct
accgttgaagaatggttcaagccagcagcctatgccctcattttgttacgccaagacggc
cttccatgtgtcttttacggagactactatgggatttcaggccagtatgctcaagaagat
ttcaaagaaatccttgaccgcctcctagccatccgaaaagacttggcctatggagaacaa
aatgactactttgaccatgctaactgtatcggttgggtacgttcaggtgctgaaaatcaa
tccccaatcgcagtccttatctcaaatgaccaagaaaacagcaagtcaatgtttgtcggt
caagaatggactaatcaaacctttgtagatttacttggtaaccaccaaggtcaagttaca
attgatgaggaaggttatggacaattccctgtctcagctagatccgtaagtgtctgggca
gtcaataccatctaa

DBGET integrated database retrieval system